Hemoglobin A1 Recombinant Protein Antigen

Images

 
There are currently no images for Hemoglobin A1 Recombinant Protein Antigen (NBP2-54711PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Hemoglobin A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Hemoglobin A1

Source: E. coli

Amino Acid Sequence: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HBA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54711.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Hemoglobin A1 Recombinant Protein Antigen

  • alpha one globin
  • alpha-1 globin
  • alpha-1-globin
  • alpha-globin
  • CD31
  • hemoglobin alpha 1 globin chain
  • Hemoglobin alpha chain
  • hemoglobin alpha-1 chain
  • hemoglobin subunit alpha
  • hemoglobin, alpha 1
  • MGC126895
  • MGC126897

Background

The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
AF4117
Species: Rt
Applications: IHC, WB
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P
AF796
Species: Mu
Applications: AdBlk, IHC, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF1320
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
H00003043-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
BBA16
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
233-FB
Species: Hu
Applications: BA
AF644
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1002
Species: Mu
Applications: Dual ISH-IHC, IHC, Simple Western, WB
NBP2-13628
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-54711PEP
Species: Hu
Applications: AC

Publications for Hemoglobin A1 Recombinant Protein Antigen (NBP2-54711PEP) (0)

There are no publications for Hemoglobin A1 Recombinant Protein Antigen (NBP2-54711PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hemoglobin A1 Recombinant Protein Antigen (NBP2-54711PEP) (0)

There are no reviews for Hemoglobin A1 Recombinant Protein Antigen (NBP2-54711PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Hemoglobin A1 Recombinant Protein Antigen (NBP2-54711PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hemoglobin A1 Products

Research Areas for Hemoglobin A1 Recombinant Protein Antigen (NBP2-54711PEP)

Find related products by research area.

Blogs on Hemoglobin A1

There are no specific blogs for Hemoglobin A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Hemoglobin A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HBA1