HEATR6 Antibody

Images

 
Western Blot: HEATR6 Antibody [NBP1-90877] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-260
Immunohistochemistry-Paraffin: HEATR6 Antibody [NBP1-90877] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HEATR6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HEATR6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HEATR6 Protein (NBP1-90877PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HEATR6 Antibody

  • ABC1
  • amplified in breast cancer 1
  • amplified in breast cancer protein 1
  • DKFZp686D22141
  • FLJ22087
  • HEAT repeat containing 6
  • HEAT repeat-containing protein 6
  • MGC148096

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14249
Species: Hu
Applications: IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15659
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56876
Species: Hu
Applications: WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB200-331
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for HEATR6 Antibody (NBP1-90877) (0)

There are no publications for HEATR6 Antibody (NBP1-90877).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEATR6 Antibody (NBP1-90877) (0)

There are no reviews for HEATR6 Antibody (NBP1-90877). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HEATR6 Antibody (NBP1-90877) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HEATR6 Products

Bioinformatics Tool for HEATR6 Antibody (NBP1-90877)

Discover related pathways, diseases and genes to HEATR6 Antibody (NBP1-90877). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HEATR6

There are no specific blogs for HEATR6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HEATR6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HEATR6