HDAC9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HDAC9 Antibody [NBP1-83274] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: HDAC9 Antibody [NBP1-83274] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts, Leydig cells were moderately stained.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HDAC9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSVSSSSPGSGPSSPNNGPTGSVTENETSVLPPTPHAEQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDAC9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HDAC9 Protein (NBP1-83274PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HDAC9 Antibody

  • EC 3.5.1.98
  • HD7b
  • HD7HDAC
  • HD9
  • HDAC7
  • HDAC7BDKFZp779K1053
  • HDRP
  • histone deacetylase 4/5-related protein
  • Histone deacetylase 7B
  • histone deacetylase 9
  • Histone deacetylase-related protein
  • KIAA0744HDAC9B
  • MEF-2 interacting transcription repressor (MITR) protein
  • MEF2-interacting transcription repressor MITR
  • MITRHDAC9FL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-22152
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56343
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-14085
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HDAC9 Antibody (NBP1-83274) (0)

There are no publications for HDAC9 Antibody (NBP1-83274).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDAC9 Antibody (NBP1-83274) (0)

There are no reviews for HDAC9 Antibody (NBP1-83274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HDAC9 Antibody (NBP1-83274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HDAC9 Products

Bioinformatics Tool for HDAC9 Antibody (NBP1-83274)

Discover related pathways, diseases and genes to HDAC9 Antibody (NBP1-83274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HDAC9 Antibody (NBP1-83274)

Discover more about diseases related to HDAC9 Antibody (NBP1-83274).
 

Pathways for HDAC9 Antibody (NBP1-83274)

View related products by pathway.

PTMs for HDAC9 Antibody (NBP1-83274)

Learn more about PTMs related to HDAC9 Antibody (NBP1-83274).
 

Research Areas for HDAC9 Antibody (NBP1-83274)

Find related products by research area.

Blogs on HDAC9

There are no specific blogs for HDAC9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HDAC9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HDAC9