HDAC6 Antibody

Images

 
Western Blot: HDAC6 Antibody [NBP1-69127] - WB Suggested Anti-Hdac6 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Mouse Liver
Immunocytochemistry/ Immunofluorescence: HDAC6 Antibody [NBP1-69127] - Human Pineal Tissue.
Immunohistochemistry: HDAC6 Antibody [NBP1-69127] - Human Adult heart Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: ...read more
Immunohistochemistry-Paraffin: HDAC6 Antibody [NBP1-69127] - Human testis tissue at an antibody concentration of 4-8ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HDAC6 Antibody Summary

Immunogen
Synthetic peptides corresponding to Hdac6 (histone deacetylase 6) The peptide sequence was selected from the N terminal of Hdac6. Peptide sequence RQRKSRHNPQSPLQDSSATLKRGGKKGAVPHSSPNLAEVKKKGKMKKLSQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDAC6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against Hdac6 and was validated on Western blot.
Theoretical MW
125 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HDAC6 Antibody

  • EC 3.5.1.98
  • HD6FLJ16239
  • histone deacetylase 6
  • JM21
  • KIAA0901

Background

The function of Hdac6 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22152
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14085
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NB100-77316
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for HDAC6 Antibody (NBP1-69127) (0)

There are no publications for HDAC6 Antibody (NBP1-69127).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDAC6 Antibody (NBP1-69127) (0)

There are no reviews for HDAC6 Antibody (NBP1-69127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HDAC6 Antibody (NBP1-69127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HDAC6 Products

Bioinformatics Tool for HDAC6 Antibody (NBP1-69127)

Discover related pathways, diseases and genes to HDAC6 Antibody (NBP1-69127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HDAC6 Antibody (NBP1-69127)

Discover more about diseases related to HDAC6 Antibody (NBP1-69127).
 

Pathways for HDAC6 Antibody (NBP1-69127)

View related products by pathway.

PTMs for HDAC6 Antibody (NBP1-69127)

Learn more about PTMs related to HDAC6 Antibody (NBP1-69127).

Blogs on HDAC6.

LAMP2: Protector of the lysosome
LAMP2 belongs to the family of membrane glycoproteins who confer selectins with carbohydrate ligands. LAMP2 has been implicated in tumor cell metastasis, as well as overall protection, maintenance, and adhesion of the lysosome. It appears that LAMP2 m...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HDAC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HDAC6