![Western Blot: HDAC6 Antibody (9V1W2) [NBP3-16082] - Western blot analysis of extracts of various cell lines, using HDAC6 antibody (NBP3-16082) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/HDAC6-Antibody-9V1W2-Western-Blot-NBP3-16082-img0002.jpg "Western Blot: HDAC6 Antibody (9V1W2) [NBP3-16082] - Western blot analysis of extracts of various cell lines, using HDAC6 antibody (NBP3-16082) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IP |
| Clone | 9V1W2 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit HDAC6 Antibody (9V1W2) (NBP3-16082) is a recombinant monoclonal antibody validated for use in IHC, WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC6 (Q9UBN7). MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCL |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | HDAC6 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for HDAC6 Antibody (NBP3-16082)Find related products by research area.
|
|
LAMP2: Protector of the lysosome LAMP2 belongs to the family of membrane glycoproteins who confer selectins with carbohydrate ligands. LAMP2 has been implicated in tumor cell metastasis, as well as overall protection, maintenance, and adhesion of the lysosome. It appears that LAMP2 m... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HDAC6 |
![Immunohistochemistry-Paraffin: HDAC6 Antibody (9V1W2) [NBP3-16082] - Immunohistochemistry of paraffin-embedded human breast cancer using HDAC6 Rabbit mAb (NBP3-16082) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HDAC6-Antibody-9V1W2-Immunohistochemistry-Paraffin-NBP3-16082-img0001.jpg "Immunohistochemistry-Paraffin: HDAC6 Antibody (9V1W2) [NBP3-16082] - Immunohistochemistry of paraffin-embedded human breast cancer using HDAC6 Rabbit mAb (NBP3-16082) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunoprecipitation: HDAC6 Antibody (9V1W2) [NBP3-16082] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug HDAC6 antibody (NBP3-16082). Western blot was performed from the immunoprecipitate using HDAC6 antibody (NBP3-16082) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/HDAC6-Antibody-9V1W2-Immunoprecipitation-NBP3-16082-img0003.jpg "Immunoprecipitation: HDAC6 Antibody (9V1W2) [NBP3-16082] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug HDAC6 antibody (NBP3-16082). Western blot was performed from the immunoprecipitate using HDAC6 antibody (NBP3-16082) at a dilition of 1:1000.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")