HCLS1 Antibody (3D5)

Images

 
Western Blot: HCLS1 Antibody (3D5) [H00003059-M01] - HCLS1 monoclonal antibody (M01), clone 3D5 Analysis of HCLS1 expression in K-562.
Immunocytochemistry/ Immunofluorescence: HCLS1 Antibody (3D5) [H00003059-M01] - Analysis of monoclonal antibody to HCLS1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: HCLS1 Antibody (3D5) [H00003059-M01] - Detection limit for recombinant GST tagged HCLS1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HCLS1 Antibody (3D5) Summary

Immunogen
HCLS1 (AAH16758, 266 a.a. - 355 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
Specificity
HCLS1 - hematopoietic cell-specific Lyn substrate 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HCLS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for ELISA.
Publications
Read Publication using H00003059-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HCLS1 Antibody (3D5)

  • Cortactin-like
  • CTTNL
  • HCLS1
  • hematopoietic cell-specific Lyn substrate 1hematopoietic lineage cell-specific protein
  • HS1lckBP1
  • LckBP1
  • p75

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
MAB6638
Species: Hu, Mu, Rt
Applications: WB
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003059-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HCLS1 Antibody (H00003059-M01)(1)

Reviews for HCLS1 Antibody (H00003059-M01) (0)

There are no reviews for HCLS1 Antibody (H00003059-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HCLS1 Antibody (H00003059-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HCLS1 Products

Bioinformatics Tool for HCLS1 Antibody (H00003059-M01)

Discover related pathways, diseases and genes to HCLS1 Antibody (H00003059-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HCLS1 Antibody (H00003059-M01)

Discover more about diseases related to HCLS1 Antibody (H00003059-M01).
 

Pathways for HCLS1 Antibody (H00003059-M01)

View related products by pathway.

PTMs for HCLS1 Antibody (H00003059-M01)

Learn more about PTMs related to HCLS1 Antibody (H00003059-M01).
 

Research Areas for HCLS1 Antibody (H00003059-M01)

Find related products by research area.

Blogs on HCLS1

There are no specific blogs for HCLS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HCLS1 Antibody (3D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol HCLS1
Entrez
OMIM
Uniprot