HAX-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: HAX-1 Antibody [NBP2-49169] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: HAX-1 Antibody [NBP2-49169] - Staining of human rectum shows moderate to strong granular cytoplasmic positivity in glandular cells and a subset of leukocytes.

Immunohistochemistry-Paraffin: HAX-1 Antibody [NBP2-49169] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HAX-1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HAX-1 Antibody - BSA Free (NBP2-49169) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HAX1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HAX-1 Recombinant Protein Antigen (NBP2-49169PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HAX-1 Antibody - BSA Free

• FLJ17042
• FLJ93803
• HAX1
• HAX-1
• HCLS1 (and PKD2) associated protein
• HCLS1 associated protein X-1
• HCLS1-associated protein X-1
• HCLSBP1
• HS1 binding protein
• HS1-associating protein X-1
• HS1-binding protein 1
• HS1BP1
• HS1BP1FLJ18492
• HSP1BP-1
• SCN3

Background

HAX1 is encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HAX1