HAX-1 Antibody

Images

 
Immunohistochemistry-Paraffin: HAX-1 Antibody [NBP2-49169] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: HAX-1 Antibody [NBP2-49169] - Staining of human rectum shows moderate to strong granular cytoplasmic positivity in glandular cells and a subset of leukocytes.
Immunohistochemistry-Paraffin: HAX-1 Antibody [NBP2-49169] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HAX-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HAX-1 Recombinant Protein Antigen (NBP2-49169PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HAX-1 Antibody

  • FLJ17042
  • FLJ93803
  • HAX1
  • HAX-1
  • HCLS1 (and PKD2) associated protein
  • HCLS1 associated protein X-1
  • HCLS1-associated protein X-1
  • HCLSBP1
  • HS1 binding protein
  • HS1-associating protein X-1
  • HS1-binding protein 1
  • HS1BP1
  • HS1BP1FLJ18492
  • HSP1BP-1
  • SCN3

Background

HAX1 is encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9167
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
H00003059-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, PLA, S-ELISA, WB
NBP2-19807
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1458
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
MCS00
Species: Mu
Applications: ELISA
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP1-80611
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33280
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-67632
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP3-03956
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF3540
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00051176-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
MCS00
Species: Mu
Applications: ELISA
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB

Publications for HAX-1 Antibody (NBP2-49169) (0)

There are no publications for HAX-1 Antibody (NBP2-49169).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAX-1 Antibody (NBP2-49169) (0)

There are no reviews for HAX-1 Antibody (NBP2-49169). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HAX-1 Antibody (NBP2-49169) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HAX-1 Products

Bioinformatics Tool for HAX-1 Antibody (NBP2-49169)

Discover related pathways, diseases and genes to HAX-1 Antibody (NBP2-49169). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAX-1 Antibody (NBP2-49169)

Discover more about diseases related to HAX-1 Antibody (NBP2-49169).
 

Pathways for HAX-1 Antibody (NBP2-49169)

View related products by pathway.

PTMs for HAX-1 Antibody (NBP2-49169)

Learn more about PTMs related to HAX-1 Antibody (NBP2-49169).
 

Research Areas for HAX-1 Antibody (NBP2-49169)

Find related products by research area.

Blogs on HAX-1

There are no specific blogs for HAX-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAX-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAX1