Home » HAX-1 » HAX-1 Antibodies » HAX-1 Antibody

HAX-1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: HAX-1 Antibody [NBP2-49169] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: HAX-1 Antibody [NBP2-49169] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: HAX-1 Antibody [NBP2-49169] - Staining of human rectum shows moderate to strong granular cytoplasmic positivity in glandular cells and a subset of leukocytes.
Immunohistochemistry-Paraffin: HAX-1 Antibody [NBP2-49169] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HAX-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HAX-1 Recombinant Protein Antigen (NBP2-49169PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HAX-1 Antibody

  • FLJ17042
  • FLJ93803
  • HAX1
  • HAX-1
  • HCLS1 (and PKD2) associated protein
  • HCLS1 associated protein X-1
  • HCLS1-associated protein X-1
  • HCLSBP1
  • HS1 binding protein
  • HS1-associating protein X-1
  • HS1-binding protein 1
  • HS1BP1
  • HS1BP1FLJ18492
  • HSP1BP-1
  • SCN3

Background

HAX1 is encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Neutrophil
Elastase/ELA2 Antibod ...
MAB9167
Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) - Azide and BSA Free [MAB9167] - Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Mouse IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils .
Flow Cytometry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - THP-1 human acute monocytic leukemia cell line treated with 3 uM monensin for 3 hours was stained with Mouse Anti-Human Neutrophil Elastase/ELA2 Monoclonal Antibody (Catalog # MAB9167, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005).
(1 Review)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
HCLS1 Antibody
(1A8)
H00003059-M02
Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of HCLS1 expression in transfected 293T cell line by HCLS1 monoclonal antibody (M02), clone 1A8.Lane 1: HCLS1 transfected lysate(54 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of protein-protein interactions between CASP3 and HCLS1. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-HCLS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of monoclonal antibody to HCLS1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, PLA, S-ELISA, WB
Phospholamban
Antibody
NBP2-19807
Western Blot: Phospholamban Antibody [NBP2-19807] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Phospholamban antibody diluted at 1:10000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Phospholamban Antibody [NBP2-19807] - Human colon carcinoma, using phospholamban antibody at 1:250 dilution.Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(3 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HTRA2/Omi Antibody
[Unconjugated]
AF1458
Western blot shows lysates of PC‑12 rat adrenal pheochromocytoma cell line, Jurkat human acute T cell leukemia cell line, HeLa human cervical epithelial carcinoma cell line, L‑929 mouse fibroblast cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 0.25 µg/mL of Rabbit Anti-Human/Mouse/Rat HTRA2/Omi Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1458) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). Specific bands were detected for HTRA2/Omi at approximately 36 and 49 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Simple Western lane view shows lysates of C2C12 mouse myoblast cell line and HeLa human cervical epithelial carcinoma cell line, loaded at 0.2 mg/mL. Specific bands were detected for HTRA2/Omi at approximately 51 kDa (precursor) and 41 kDa (processed) (as indicated) using 2.5 µg/mL of Rabbit Anti-Human/Mouse/Rat HTRA2/Omi Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1458). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
HTRA2/Omi was detected in immersion fixed Jurkat human acute T cell leukemia cell line stimulated with staurosporin using Rabbit Anti-Human/Mouse/Rat HTRA2/Omi Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1458) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (yellow; Catalog # NL004) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(24 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
G-CSF [HRP]
MCS00
(48 Publications)
Species: Mu
Applications: ELISA
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase‑3 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Rabbit Anti-Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Caspase‑3 was detected in immersion fixed Jurkat human acute T cell leukemia cell line stimulated with staurosporin using Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (yellow; Catalog # NL004) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(7 Reviews)
(200 Publications)
Species: Hu, Mu
Applications: ICC, IHC
14-3-3 Antibody
NBP2-27202
Simple Western: 14-3-3 Antibody [NBP2-27202] - Analysis in mouse brain lysate. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: 14-3-3 Antibody [NBP2-27202] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-14-3-3 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: 14-3-3 Antibody [NBP2-27202] - analysis of 14-3-3 using 14-3-3 antibody. Human Brain tissue lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain, and 4) rat brain lysate probed with 2 ug/ml of 14-3-3 antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(1 Review)
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
14-3-3 beta/alpha
Antibody
NBP1-80611
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Analysis in human cerebral cortex and pancreas tissues. Corresponding YWHAB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EEF1A2 Antibody
NBP2-33280
Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
WASP Antibody
NB300-996
Immunohistochemistry-Paraffin: WASP Antibody [NB300-996] - Staining of paraffin embedded Human Spleen. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunocytochemistry/Immunofluorescence: WASP Antibody [NB300-996] - Immunofluorescence analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunocytochemistry/Immunofluorescence: WASP Antibody [NB300-996] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Cortactin Antibody
(SC61-08)
NBP2-67632
Flow Cytometry: Cortactin Antibody (SC61-08) [NBP2-67632] - Analysis of Hela cells with Cortactin antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Cortactin Antibody (SC61-08) [NBP2-67632] - Staining Cortactin in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Cortactin Antibody (SC61-08) [NBP2-67632] - Staining Cortactin in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
G6PC3 Antibody
NBP3-03956
Western Blot: G6PC3 Antibody [NBP3-03956] - Analysis of extracts of various cell lines, using G6PC3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: G6PC3 Antibody [NBP3-03956] - Analysis of extracts of 293T cells, using G6PC3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 3s.
Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of A-549 cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - EA reduced MPP+-induced dopaminergic neuronal apoptosis by increasing BDNF (brain-derived neurotrophic factor) expression and further Akt phosphorylation in the rat substantia nigra. Eight days after MPP+ administration, our Western blot results (MAB7566) show that MPP+ treatment reduced tyrosine hydroxylase and Bcl-2 expression in the ipsilateral side of the rat substantia nigra (SN), but not in the contralateral side. EA stimulation (50 Hz) enhanced mature BDNF, tyrosine hydroxylase, and Bcl-2 expression in the MPP+-treated ipsilateral side. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/18/9/1846), licensed under a CC-BY licence.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 using this antibody at 1:2000, 20 ug/protein was loaded per lane. (1) Human Jurkat T cells. (2) Human RS11 lymphoma cells. (3-6) Human breast cancer cases. Patient sample in lane 5 lacked detectible Bcl-2 expression.
(2 Reviews)
(16 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
GFI-1 Antibody
[Unconjugated]
AF3540
THP-1 monocytic leukemia cell line was stained with Goat Anti-Human GFI-1SOX2 Affinity Purified Polyclonal Antibody (Catalog # AF3540, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by APC-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
(5 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Caspase-9 Antibody
NB100-56118
Immunohistochemistry: Caspase-9 Antibody [NB100-56118] - Exacerbated apoptosis and altered inflammation in double-deficient Atg7deltapan-Rip3-/- mice. (c) Depletion of Rip3 and pancreatic Atg7 (Atg7deltapan-Rip3d/d) increased pancreatic caspase-9 in 12-week-old mice. Caspase-9 quantitation and representative IF microphotographs of Atg7deltapan (n=5) and Atg7deltapan-Rip3d/d (n=5) pancreatic tissue stained for DAPI (blue) and Caspase-9 (red) (1/1000).. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/cddis.2017.313), licensed under a CC-BY licence.
Immunohistochemistry: Caspase-9 Antibody [NB100-56118] - Autophagy-deficient mice showed increased activity of apoptosis and necroptosis. Increased the expression of Caspase-9 in 12-week-old Atg7deltapan mice. Caspase-9 quantitation and representative IF microphotographs of Atg7F/F (n=5) and Atg7deltapan (n=5) pancreatic tissue stained for DAPI (blue) and Caspase-9 (green) (1/1000, scale bar=50?um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/cddis.2017.313), licensed under a CC-BY licence.
Immunohistochemistry: Caspase-9 Antibody [NB100-56118] - Mice with two different spontaneous mutant alleles of Sharpin show variations in onset of CPDM phenotype. However, the onset is much more rapid in Sharpincpdm-Dem mice as evidenced by antibody detection of cleaved CASPASE 9 (T) when compared to Sharpincpdm mutants (R) or WT mice (Q,S). . Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0085666) licensed under a CC-BY licence.
(1 Review)
(21 Publications)
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
LEF1 Antibody (3H5)
H00051176-M01
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - Analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi ( Cat # H00051176-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with LEF1 monoclonal antibody (M01), clone 3H5 (Cat # H00051176-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: LEF1 Antibody (3H5) [H00051176-M01] - Detection limit for recombinant GST tagged LEF1 is approximately 0.3ng/ml as a capture antibody.
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - LEF1 monoclonal antibody (M01), clone 3H5. Analysis of LEF1 expression in HL-60.
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
G-CSF [HRP]
MCS00
(48 Publications)
Species: Mu
Applications: ELISA
XIAP Antibody
[Unconjugated]
AF8221
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, C2C12 mouse myoblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for XIAP at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and C2C12 mouse myoblast cell line, loaded at 0.2 mg/mL. A specific band was detected for XIAP at approximately 59 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and XIAP knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for XIAP at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockoutHeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(15 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB

Publications for HAX-1 Antibody (NBP2-49169) (0)

There are no publications for HAX-1 Antibody (NBP2-49169).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAX-1 Antibody (NBP2-49169) (0)

There are no reviews for HAX-1 Antibody (NBP2-49169). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HAX-1 Antibody (NBP2-49169) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HAX-1 Products

Bioinformatics Tool for HAX-1 Antibody (NBP2-49169)

Discover related pathways, diseases and genes to HAX-1 Antibody (NBP2-49169). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAX-1 Antibody (NBP2-49169)

Discover more about diseases related to HAX-1 Antibody (NBP2-49169).
 

Pathways for HAX-1 Antibody (NBP2-49169)

View related products by pathway.

PTMs for HAX-1 Antibody (NBP2-49169)

Learn more about PTMs related to HAX-1 Antibody (NBP2-49169).
 

Research Areas for HAX-1 Antibody (NBP2-49169)

Find related products by research area.

Blogs on HAX-1

There are no specific blogs for HAX-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAX-1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HAX1