![Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target Name: G6PC3. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/G6PC3-Antibody-Western-Blot-NBP2-82857-img0005.jpg "Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target Name: G6PC3. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human G6PC3. Peptide sequence: ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | G6PC3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Publication using NBP2-82857 | Applications | Species |
|---|---|---|
| Yuan Y, Zhu C, Wang Y et al. alpha-Ketoglutaric acid ameliorates hyperglycemia in diabetes by inhibiting hepatic gluconeogenesis via serpina1e signaling Science advances 2022-05-06 [PMID: 35507647] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
Research Areas for G6PC3 Antibody (NBP2-82857)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | G6PC3 |
![Western Blot: G6PC3 Antibody [NBP2-82857] - WB Suggested Anti-G6PC3 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellG6PC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells](http://images.novusbio.com/fullsize/G6PC3-Antibody-Western-Blot-NBP2-82857-img0001.jpg "Western Blot: G6PC3 Antibody [NBP2-82857] - WB Suggested Anti-G6PC3 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellG6PC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells")
![Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target Name: G6PC3. Sample Type: Hela. Antibody Dilution: 1.0ug/mlG6PC3 is strongly supported by BioGPS gene expression data to be expressed in HeLa](http://images.novusbio.com/fullsize/G6PC3-Antibody-Western-Blot-NBP2-82857-img0002.jpg "Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target Name: G6PC3. Sample Type: Hela. Antibody Dilution: 1.0ug/mlG6PC3 is strongly supported by BioGPS gene expression data to be expressed in HeLa")
![Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target Name: G6PC3. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/G6PC3-Antibody-Western-Blot-NBP2-82857-img0003.jpg "Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target Name: G6PC3. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml")
![Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target Name: G6PC3. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/G6PC3-Antibody-Western-Blot-NBP2-82857-img0004.jpg "Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target Name: G6PC3. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml")
![Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target: G6PC3. Positive control (+): MCF7 (N10). Negative control (-): Human Placenta (PL). Antibody concentration: 1ug/ml](http://images.novusbio.com/fullsize/G6PC3-Antibody-Western-Blot-NBP2-82857-img0006.jpg "Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target: G6PC3. Positive control (+): MCF7 (N10). Negative control (-): Human Placenta (PL). Antibody concentration: 1ug/ml")
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Immunocytochemistry/ Immunofluorescence UGRP1/SCGB3A2 Antibody [Unconjugated]](https://images.novusbio.com/images/af3465_mouse-ugrp1-affinity-purified-pab-41202412405138.jpg)
![Intracellular Staining by Flow Cytometry GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GFI1_AF3540_Flow_Cytometry_23623.jpg)
![Western Blot GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3540_human-gfi-1-affinity-purified-polyclonal-ab-41202412394973.jpg)
![Western Blot GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3540_human-gfi-1-affinity-purified-polyclonal-ab-41202412401266.jpg)
![Neutralization G-CSF Antibody (67604) [Unconjugated]](https://images.novusbio.com/images2/G-CSF_MAB414_Block_Neutralize_9188.jpg)
![Immunohistochemistry G-CSF Antibody (67604) [Unconjugated]](https://images.novusbio.com/images/mab414_mouse-g-csf-mab-clone-67604-immunohistochemistry-121220257434724.jpg)
![Flow Cytometry G-CSF Antibody (67604) [Unconjugated]](https://images.novusbio.com/images/mab414_mouse-g-csf-mab-clone-67604-flow-cytometry-12122025815217.jpg)
![Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]](https://images.novusbio.com/images2/Uteroglobin_MAB4218_Immunohistochemistry_7019.jpg)
![Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]](https://images.novusbio.com/images2/Uteroglobin_MAB4218_Immunohistochemistry_9991.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/IL-5_M5000_ELISA_237.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/DATA_IL5_M5000_ELISA_935.jpg)
![Western Blot G-CSFR/CD114 Antibody (38660) [Unconjugated]](https://images.novusbio.com/images2/GCSF_R_MAB381_Western_Blot_12716.jpg)
![Flow Cytometry G-CSFR/CD114 Antibody (38660) [Unconjugated]](https://images.novusbio.com/images2/mab381_human-g-csf-r-cd114-mab-clone-38660-flow-cytometry-142021122939.jpg)
![Immunocytochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunocytochemistry_6578.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunohistochemistry_6959.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images/mab1904_human-scgf-clec11a-mab-clone-239029-4120241252123.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
