Recombinant Human HAND2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HAND2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 135-216 of Human HAND2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HAND2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HAND2 Protein

  • BHLHA26
  • bHLHa26MGC125303
  • dHand
  • DHAND2
  • Ehand2
  • FLJ16260
  • HAND2
  • heart and neural crest derivatives expressed 2
  • heart, autonomic nervous system and neural crestderivatives-expressed protein 2
  • Hed
  • MGC125304
  • Th2
  • Thing2

Background

The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00576
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
NBP2-41169
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
AF4940
Species: Hu, Mu
Applications: ICC
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF922
Species: Hu
Applications: WB, Block
NBP2-13958
Species: Hu
Applications: IHC, IHC-P

Publications for HAND2 Partial Recombinant Protein (H00009464-Q01) (0)

There are no publications for HAND2 Partial Recombinant Protein (H00009464-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAND2 Partial Recombinant Protein (H00009464-Q01) (0)

There are no reviews for HAND2 Partial Recombinant Protein (H00009464-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HAND2 Partial Recombinant Protein (H00009464-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HAND2 Products

Bioinformatics Tool for HAND2 Partial Recombinant Protein (H00009464-Q01)

Discover related pathways, diseases and genes to HAND2 Partial Recombinant Protein (H00009464-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAND2 Partial Recombinant Protein (H00009464-Q01)

Discover more about diseases related to HAND2 Partial Recombinant Protein (H00009464-Q01).
 

Pathways for HAND2 Partial Recombinant Protein (H00009464-Q01)

View related products by pathway.

PTMs for HAND2 Partial Recombinant Protein (H00009464-Q01)

Learn more about PTMs related to HAND2 Partial Recombinant Protein (H00009464-Q01).
 

Research Areas for HAND2 Partial Recombinant Protein (H00009464-Q01)

Find related products by research area.

Blogs on HAND2

There are no specific blogs for HAND2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HAND2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HAND2
Entrez