HADH Antibody (3C9)

Images

 
Western Blot: HADH Antibody (3C9) [H00003033-M02] - HADHSC monoclonal antibody (M02), clone 3C9. Analysis of HADHSC expression in HepG2.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3C9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HADH Antibody (3C9) Summary

Immunogen
HADHSC (NP_005318 205 a.a. - 314 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Specificity
HADHSC - L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain (3C9)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HADH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HADH Antibody (3C9)

  • EC 1.1.1
  • EC 1.1.1.35
  • HADH1
  • HADHSChydroxyacyl-Coenzyme A dehydrogenase
  • HCDH
  • hydroxyacyl-CoA dehydrogenase
  • L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain
  • Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase
  • MGC8392
  • mitochondrial
  • MSCHAD
  • SCHADHHF4

Background

This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP1-54755
Species: Hu
Applications: WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu

Publications for HADH Antibody (H00003033-M02) (0)

There are no publications for HADH Antibody (H00003033-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HADH Antibody (H00003033-M02) (0)

There are no reviews for HADH Antibody (H00003033-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HADH Antibody (H00003033-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HADH Products

Bioinformatics Tool for HADH Antibody (H00003033-M02)

Discover related pathways, diseases and genes to HADH Antibody (H00003033-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HADH Antibody (H00003033-M02)

Discover more about diseases related to HADH Antibody (H00003033-M02).
 

Pathways for HADH Antibody (H00003033-M02)

View related products by pathway.

PTMs for HADH Antibody (H00003033-M02)

Learn more about PTMs related to HADH Antibody (H00003033-M02).
 

Research Areas for HADH Antibody (H00003033-M02)

Find related products by research area.

Blogs on HADH

There are no specific blogs for HADH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HADH Antibody (3C9) and receive a gift card or discount.

Bioinformatics

Gene Symbol HADH
Entrez
Uniprot