H1FOO Antibody - BSA Free

Immunohistochemistry-Paraffin: H1FOO Antibody [NBP1-86265] - Analysis in human testis and tonsil tissues using NBP1-86265 antibody. Corresponding H1FOO RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: H1FOO Antibody [NBP1-86265] - Staining of human Testis shows moderate nuclear positivity in spermatids.

Immunohistochemistry-Paraffin: H1FOO Antibody [NBP1-86265] - Staining of human Tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: H1FOO Antibody [NBP1-86265] - Staining of human Liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: H1FOO Antibody [NBP1-86265] - Staining of human Pancreas shows no positivity in exocrine glandular cells as expected.

Analysis in control (vector only transfected HEK293T lysate) and H1FOO over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

H1FOO Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: H1FOO
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  H1FOO Protein (NBP1-86265PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for H1FOO Antibody - BSA Free

• H1 histone family, member O, oocyte-specific
• H1OO
• histone H1oo
• MGC50807
• Oocyte-specific histone H1
• Oocyte-specific linker histone H1
• osH1

Background

Histones are nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber as they play a critical role in transcription regulation, DNA repair, DNA replication, and chromosomal stability. The H1FOO gene encodes a H1 Histone Family, member O, oocyte-specific protein. One isoform is 346 amino acids long at 35 kDA while isoform 2 is 207 amino acids long at 21 kDA. The replacement of H1c with H1FOO may be critical to nuclear remodeling as greater mobility of H1FOO increases stability of the embryonic chromatin structure. H1FOO participates in histone modification and cell cycle chromosome condensation in prometaphase. H1FOO has been studied in regards to premature ovarian failure.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: H1FOO