H1FOO Antibody

Images

 
Western Blot: H1FOO Antibody [NBP1-86265] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: H1FOO Antibody [NBP1-86265] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.
Immunohistochemistry-Paraffin: H1FOO Antibody [NBP1-86265] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

H1FOO Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
H1FOO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
H1FOO Protein (NBP1-86265PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for H1FOO Antibody

  • H1 histone family, member O, oocyte-specific
  • H1OO
  • histone H1oo
  • MGC50807
  • Oocyte-specific histone H1
  • Oocyte-specific linker histone H1
  • osH1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30830
Species: Hu
Applications: IHC, IHC-P
NBL1-17958
Species: Hu
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86823
Species: Hu
Applications: IHC, IHC-P
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NBP2-49202
Species: Hu
Applications: IHC
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-80104
Species: Hu
Applications: WB
H00388112-B01P
Species: Hu
Applications: WB, ELISA
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16847
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47347
Species: Hu
Applications: WB, IHC
NBP1-86265
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for H1FOO Antibody (NBP1-86265) (0)

There are no publications for H1FOO Antibody (NBP1-86265).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H1FOO Antibody (NBP1-86265) (0)

There are no reviews for H1FOO Antibody (NBP1-86265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for H1FOO Antibody (NBP1-86265) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional H1FOO Products

Bioinformatics Tool for H1FOO Antibody (NBP1-86265)

Discover related pathways, diseases and genes to H1FOO Antibody (NBP1-86265). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for H1FOO Antibody (NBP1-86265)

Discover more about diseases related to H1FOO Antibody (NBP1-86265).
 

Pathways for H1FOO Antibody (NBP1-86265)

View related products by pathway.

PTMs for H1FOO Antibody (NBP1-86265)

Learn more about PTMs related to H1FOO Antibody (NBP1-86265).

Blogs on H1FOO

There are no specific blogs for H1FOO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our H1FOO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol H1FOO