GW182 Antibody - BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 950-1050 of human GW182 (NP_055309.2). QDIVGSWGIPPATGKPPGTGWLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNGNSRSDQQAQVHQLLTPASAIS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TNRC6A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50-1:100
- Western Blot 1:500-1:1000
|
| Theoretical MW |
210 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GW182 Antibody - BSA Free
Background
GW182 (glycine-tryptophan protein of 182 kDa) is a member of the trinucleotide repeat containing 6 protein family. It functions in post-transcriptional gene silencing through the RNA interference (RNAi) and microRNA pathways. GW182 has been found to associate with messenger RNAs and Argonaute proteins in cytoplasmic bodies known as GW-bodies or P-bodies. Inhibition of GW182 expression delocalizes other GW-body proteins and impairs RNAi and microRNA-induced gene silencing.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IP, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for GW182 Antibody (NBP3-03014) (0)
There are no publications for GW182 Antibody (NBP3-03014).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GW182 Antibody (NBP3-03014) (0)
There are no reviews for GW182 Antibody (NBP3-03014).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GW182 Antibody (NBP3-03014) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GW182 Products
Blogs on GW182