TNRC6C Antibody

Images

 
Immunohistochemistry-Paraffin: TNRC6C Antibody [NBP2-13462] - Staining of human lymph node shows strong cytoplasmic positivity in subset of non germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TNRC6C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ATQASNSGGKNDGSIMNSTNTSSVSGWVNAPPAAVPANTGWGDSNNKAPS GPGVWGDSISSTAVSTAAAAKSGHAWSGAANQEDKSPTWGEPPKPKSQHW GDGQRSNPAWSAGGGDWADSSS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNRC6C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TNRC6C Protein (NBP2-13462PEP)
Publications
Read Publication using
NBP2-13462 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TNRC6C Antibody

  • KIAA1582FLJ20015
  • trinucleotide repeat containing 6C
  • trinucleotide repeat-containing gene 6C protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28751
Species: Hu, Mu
Applications: IB, IP, KD, WB
NBP1-57549
Species: Hu
Applications: WB
NBP1-59631
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB120-6125
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
MAB6967
Species: Hu
Applications: WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-90063
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB120-13888
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
NBP1-89606
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-71691
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24725
Species: Eq, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00748
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88713
Species: Hu
Applications: IHC, IHC-P, WB

Publications for TNRC6C Antibody (NBP2-13462)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TNRC6C Antibody (NBP2-13462) (0)

There are no reviews for TNRC6C Antibody (NBP2-13462). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TNRC6C Antibody (NBP2-13462) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TNRC6C Products

Bioinformatics Tool for TNRC6C Antibody (NBP2-13462)

Discover related pathways, diseases and genes to TNRC6C Antibody (NBP2-13462). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNRC6C Antibody (NBP2-13462)

Discover more about diseases related to TNRC6C Antibody (NBP2-13462).
 

Pathways for TNRC6C Antibody (NBP2-13462)

View related products by pathway.

Blogs on TNRC6C

There are no specific blogs for TNRC6C, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNRC6C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNRC6C