GW182 Antibody

Images

 
Immunohistochemistry: GW182 Antibody [NBP1-88231] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells. Mesenchymal cells were distinctly stained.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GW182 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QLQRLLAQQQRAQSQRSVPSGNRPQQDQQGRPLSVQQQMMQQSRQLDPNLLVKQQTPPSQQQPLHQPAMKSFLDNVMPHTTPELQKGPSPINAFSNFPIGLNSNLNVNMDMNSIKEPQSRLRKWT
Marker
P/GW Body Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNRC6A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GW182 Antibody

  • CAG repeat protein 26
  • CAGH26FLJ22043
  • DKFZp666E117
  • EMSY interactor protein
  • Glycine-tryptophan protein of 182 kDa
  • GW182 autoantigen
  • GW182GW1
  • KIAA1460EDIE
  • MGC75384
  • Protein GW1
  • TNRC6
  • trinucleotide repeat containing 6
  • trinucleotide repeat containing 6A
  • trinucleotide repeat-containing gene 6A protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-83680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16267
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP2-13462
Species: Hu
Applications: IHC, IHC-P
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP1-81442
Species: Hu
Applications: IHC, IHC-P
NB500-191
Species: Hu, Mu
Applications: WB, IP, PLA
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported

Publications for GW182 Antibody (NBP1-88231) (0)

There are no publications for GW182 Antibody (NBP1-88231).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GW182 Antibody (NBP1-88231) (0)

There are no reviews for GW182 Antibody (NBP1-88231). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GW182 Antibody (NBP1-88231) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GW182 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNRC6A