GTP-binding protein 1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GTP-binding protein 1 Antibody [NBP2-56040] - Staining of human cell line HEK 293 shows localization to nuclear bodies, cytosol & the Golgi apparatus.

Immunohistochemistry-Paraffin: GTP-binding protein 1 Antibody [NBP2-56040] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GTP-binding protein 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQ
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GTPBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. IHC-P, Retrieval method: HIER pH6.
• Control Peptide:

  GTP-binding protein 1 Recombinant Protein Antigen (NBP2-56040PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GTP-binding protein 1 Antibody - BSA Free

• GP1GTP-binding protein 1
• GP-1MGC20069
• G-protein 1
• GTP binding protein 1
• HSPC018

Background

GTPBP1, also known as GTP-binding protein 1, is a 669 amino acid that is approx. 72 kDa, stimulates degradation of target mRNA species, binds GTP, is important for the regulation of circadian mRNA stability, and has GTPase activity. Studies on this protein have shown a relationship with the following disorders and diseases: lassa fever, fragile x syndrome, lymphocytic choriomeningitis, antiphospholipid syndrome, lupus erythematosus, adenoma, and interferon. This protein interacts with EXOSC2/RRP4, EXOSC3/RRP40, EXOSC5/RRP46, HNRNPD, HNRNPR, SYNCRIP, LRP1, SQSTM1, ABCF1, and MAP1LC3B in GTP catabolic process, positive regulation of mRNA catabolic process, signal transduction, and immune response pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GTPBP1