GTPBP2 Antibody

Images

 
Western Blot: GTPBP2 Antibody [NBP1-85924] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: GTPBP2 Antibody [NBP1-85924] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GTPBP2 Antibody [NBP1-85924] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: GTPBP2 Antibody [NBP1-85924] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: GTPBP2 Antibody [NBP1-85924] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTPBP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVP
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTPBP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTPBP2 Protein (NBP1-85924PEP)
Publications
Read Publication using NBP1-85924.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GTPBP2 Antibody

  • GTP binding protein 2
  • GTP-binding protein 2
  • MGC74725

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20029
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00135138-D01P
Species: Hu, Mu
Applications: WB
DCLU00
Species: Hu
Applications: ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB2688
Species: Hu
Applications: WB
AF3417
Species: Hu
Applications: WB
H00010721-M09
Species: Hu
Applications: ELISA, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-52575
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF1438
Species: Hu
Applications: IHC, WB
NBP1-98549
Species: Hu
Applications: WB
NB300-514
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
DHAPG0
Species: Hu
Applications: ELISA
NBP1-85924
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GTPBP2 Antibody (NBP1-85924)(1)

Reviews for GTPBP2 Antibody (NBP1-85924) (0)

There are no reviews for GTPBP2 Antibody (NBP1-85924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTPBP2 Antibody (NBP1-85924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GTPBP2 Products

Bioinformatics Tool for GTPBP2 Antibody (NBP1-85924)

Discover related pathways, diseases and genes to GTPBP2 Antibody (NBP1-85924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTPBP2 Antibody (NBP1-85924)

Discover more about diseases related to GTPBP2 Antibody (NBP1-85924).
 

Pathways for GTPBP2 Antibody (NBP1-85924)

View related products by pathway.

Blogs on GTPBP2

There are no specific blogs for GTPBP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTPBP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTPBP2