GTPBP2 Antibody

Western Blot: GTPBP2 Antibody [NBP1-85924] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: GTPBP2 Antibody [NBP1-85924] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GTPBP2 Antibody [NBP1-85924] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuropil.

Immunohistochemistry-Paraffin: GTPBP2 Antibody [NBP1-85924] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Immunohistochemistry-Paraffin: GTPBP2 Antibody [NBP1-85924] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GTPBP2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVP
• Predicted Species: Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GTPBP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GTPBP2 Protein (NBP1-85924PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GTPBP2 Antibody

• GTP binding protein 2
• GTP-binding protein 2
• MGC74725

Background

GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GTPBP2 Antibody (NBP1-85924)(1)

Publication using NBP1-85924

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: GTPBP2