gtf3c3 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human gtf3c3. Source: E. coli Amino Acid Sequence: RETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPTNVRYLWERSSLYEQMGD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
GTF3C3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56032. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for gtf3c3 Recombinant Protein Antigen
Background
General transcription factor 3C polypeptide 3 (GTF3C3/TFIIIC102) is a subunit of the TFIIIC DNA-binding factor required for transcription of tRNA and 5S rRNA genes by RNA polymerase III. Human TFIIIC is composed of six subunits: TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, and TFIIIC35. GTF3C3/TFIIIC102 appears to be important for stable complex formation and recruitment of RNA polymerase III by interacting with TFIIIB90, TBP, and TFIIIC63. GTF3C3/TFIIIC102 has been shown to also interact with DEDD and FLAME-3 proteins. This interaction may function to translocate GTF3C3/TFIIIC102 to the nucleus and regulate TFIIIC activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP (-), WB
Species: Bv, Ca, Hu, Pm, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: AC
Publications for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP) (0)
There are no publications for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP) (0)
There are no reviews for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP) (0)
Additional gtf3c3 Products
Blogs on gtf3c3