Home » gtf3c3 » gtf3c3 Proteins » gtf3c3 Recombinant Protein Antigen

gtf3c3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

gtf3c3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human gtf3c3.

Source: E.coli

Amino Acid Sequence: RETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPTNVRYLWERSSLYEQMGD
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GTF3C3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-56032 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for gtf3c3 Recombinant Protein Antigen

  • general transcription factor 3C polypeptide 3
  • general transcription factor IIIC, polypeptide 3, 102kDa
  • TF3C-gamma
  • TFIIIC 102 kDa subunit
  • TFIIIC102general transcription factor IIIC, polypeptide 3 (102kD)
  • TFiiiC2-102
  • TFIIICgamma
  • Transcription factor IIIC 102 kDa subunit
  • Transcription factor IIIC subunit gamma
  • transcription factor IIIC, 102 kD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TFIIIC Antibody
NB100-60656
Immunohistochemistry: TFIIIC Antibody [NB100-60656] - Sample: FFPE section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-GTF3C1/TFIIIC220 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: TFIIIC Antibody [NB100-60656] - FFPE section of human thyroid carcinoma. Affinity purified rabbit anti-TFIIIC used at a dilution of 1:250. Detection: DAB staining using Immunohistochemistry Accessory Kit
Immunohistochemistry-Paraffin: TFIIIC Antibody [NB100-60656] - FFPE section of human breast carcinoma. Affinity purified rabbit anti-TFIIIC used at a dilution of 1:250. Detection: DAB staining using Immunohistochemistry Accessory Kit
Species: Hu
Applications: IHC, IHC-P, IP
DEDD2 Antibody
NB100-56137
DEDD2 Antibody
Species: Hu, Rt, Bv, Ca, Pm
Applications: WB, IHC, IHC-P, IP
FLIP Antibody
NB100-56141
Western Blot: FLIP Antibody [NB100-56141] - analysis of FLIP in human ovarian cancer cell lines using anti-FLIP antibody. The primary antibody was used at a dilution of 1:200 and incubated for overnight at 4C in 5% milk in PBST. Image from verified customer review.
Immunohistochemistry: FLIP Antibody [NB100-56141] - Immunhohistochemical analysis of FLIP in tissues cores from a formalin-fixed, paraffin-embedded human brain tumor microarray using NB100-56141 at 1:2000. A-C, tissue cores from a patient with gemistocytoma. A, normal adjacent brain tissue. Astrocytes are positive for Flip expression. B, gemistocytoma (Grade II). Gemistocytes are positive for Flip expression. C, peritumoural oedma brain tissue. Reactive astrocytocytes are positive for FLIP expression. C1, a higher magnification of C. Collectively, the data shows that astrocytes (normal), reactive astrocytes and gemistocytes are positive for Flip expression. Hematoxylin-eosin counterstain.
Immunohistochemistry: FLIP Antibody [NB100-56141] - Immunhohistochemical analysis of FLIP in two tissues cores from a formalin-fixed, paraffin-embedded human brain tumor microarray using NB100-56141 at 1:2000. A, gemistocytoma (Grade II) positive for FLIP expression. B, gemistocytoma (Grade II) negative for FLIP expression. A1 and A2 are higher magnifications from A. A, A1, and A2 show expression of FLIP in the gemistocytes of the tumor. Hematoxylin-eosin counterstain.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Caspase-10/FLICE2
Antibody
NB100-56123
Caspase-10/FLICE2 Antibody
(1 Publication)
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Caspase-8 Antibody
- (active/cleaved)
NB100-56116
Western Blot: active/cleaved Caspase 8 Antibody [NB100-56116] - Analysis of active/cleaved Caspase 8 in NRK whole cell lysate using anti-active/cleaved Caspase 8 antibody. Image from verified customer review.
Immunohistochemistry: active/cleaved Caspase 8 Antibody [NB100-56116] - Formalin-fixed, paraffin-embedded sections from a brain tissue array stained for Caspase-8 expression using NB100-56116 at 1:2000. A. Normal brain stem (1) and cortex (2). B. Higher magnification of cortex (from A). C. Higher magnification of brain stem (from A). D. Normal cerebellum showing caspase-8 staining in the Purkinge cells.
Immunohistochemistry: active/cleaved Caspase 8 Antibody [NB100-56116] - Formalin-fixed, paraffin-embedded sections from a brain tumor tissue array stained for Caspase-8 expression using NB100-56116 at 1:2000. A. Anaplastic glioma (Grade III, left) and Gemistocytoma (Grade II, right) cores showing negative and positive staining for Caspase-8, respectively. B. Higher magnification of the Gemistocytoma tumor (from A).
(1 Review)
(36 Publications)
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
EphB2 Antibody
[Unconjugated]
AF467
COLO 205 human colorectal adenocarcinoma cell line was stained with Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467, filled histogram) or isotype control antibody (Catalog #AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
D3 mouse embryonic stem cell line was stained with Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467, filled histogram) or isotype control antibody (Catalog #AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
EphB2 was detected in immersion fixed paraffin-embedded sections of human esophageal squamous cell carcinoma using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in cancer cells. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(8 Reviews)
(26 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
DEDD Antibody
NBP1-31686
Western Blot: DEDD Antibody [NBP1-31686] - Sample (30 ug of whole cell lysate) A: Raji 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: DEDD Antibody [NBP1-31686] - Paraformaldehyde-fixed HeLa, using DEDD antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2500.
Species: Hu
Applications: WB, ICC/IF
FADD Antibody
NBP1-81831
Western Blot: FADD Antibody [NBP1-81831] - Analysis in human cell lines A-431 and HeLa using Anti-FADD antibody. Corresponding FADD RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunocytochemistry/Immunofluorescence: FADD Antibody [NBP1-81831] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: FADD Antibody [NBP1-81831] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - analysis of human breast tumor tissue using an isotype control antibody (top) and p50 antibody (bottom) at 5 ug/ml.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC-P
Glutathione S
Transferase kappa 1 A ...
NBP1-89727
Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining in human small intestine and pancreas tissues using anti-GSTK1 antibody. Corresponding GSTK1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
PPIG Antibody
NBP1-19117
Western Blot: PPIG Antibody [NBP1-19117] - Whole cell lysate from HeLa cells. SRcyp was also immunoprecipitated by rabbit anti-SRcyp antibody NBP1-19116.
Immunohistochemistry-Paraffin: PPIG Antibody [NBP1-19117] - FFPE section of human ovarian carcinoma. Affinity purified rabbit anti-SRcyp used at a dilution of 1:250. Detection: DAB staining using Immunohistochemistry Accessory Kit
Immunohistochemistry: PPIG Antibody [NBP1-19117] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- SRcyp used at a dilution of 1:200 (1ug/ml). Detection: DAB
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MCAF1 Antibody
NBP1-84609
Western Blot: MCAF1 Antibody [NBP1-84609] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: MCAF1 Antibody [NBP1-84609] - Staining of human cell line U-251 MG shows localization to nucleoplasm and nuclear bodies.
Immunohistochemistry-Paraffin: MCAF1 Antibody [NBP1-84609] - Staining in human testis and skeletal muscle tissues using anti-ATF7IP antibody. Corresponding ATF7IP RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
SOX2 Antibody
(245610) [Unconjugate
MAB2018
SOX2 was detected in immersion fixed BG01V human embryonic stem cells using Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
NTera‑2 human testicular embryonic carcinoma cell line was stained with Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005).  View our protocol for Staining Intracellular Molecules.
Western blot shows lysates of NTera‑2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, D3 mouse embryonic stem cell line, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(11 Reviews)
(73 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Myoglobin Antibody
(SC06-38)
NBP2-67599
Western Blot: Myoglobin Antibody (SC06-38) [NBP2-67599] - Analysis of Myoglobin on human skeletal muscle lysates using anti-Myoglobin antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Myoglobin Antibody (SC06-38) [NBP2-67599] - Staining Myoglobin in C2C12 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Myoglobin Antibody (SC06-38) [NBP2-67599] - Analysis of paraffin-embedded mouse skeletal muscle tissue using anti-Myoglobin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
TAF15 Antibody
(4D71)
NBP1-92685
Western Blot: TAF15 Antibody (4D71) [NBP1-92685] - Analysis of cytosol or nuclear enriched fractions of cell line lysates using mouse mAb to TAF15, NBP1-92685, dilution 1:1,000: [1] protein standard, [2] NIH-3T3 cytosol, [3] NIH-3T3 nuclear fraction, [4] HeLa cytosol, and [5] HeLa nuclear fraction.Double band at 56-68kDa detected predominantly in the nuclear enriched fraction corresponds to the TAF15 protein.
Immunocytochemistry/Immunofluorescence: TAF15 Antibody (4D71) [NBP1-92685] - Analysis of HeLa cells stained with mouse mAb to TATA-box binding protein associated factor 15, TAF15, NBP1-92685, dilution 1:500 in red, and costained with rabbit pAb to GAPDH, dilution 1:1,000 in green. Blue is Hoechst staining of nuclear DNA. The NBP1-92685 antibody reveals TAF15 protein expressed exclusively in the nuclei of the cells, while GAPDH antibody produces strong cytoplasmic staining.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
TNIP1 Antibody
NBP1-89306
Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
HDAC5 Antibody
NBP2-22152
Western Blot: HDAC5 Antibody [NBP2-22152] - LNCaP cells with normal medium and with androgen depletion. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: HDAC5 Antibody [NBP2-22152] - HDAC5 antibody was tested in A431 cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry: HDAC5 Antibody [NBP2-22152] - IHC analysis of HDAC5 in mouse pancreas.
(1 Review)
(1 Publication)
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Muscarinic
Acetylcholine Recepto ...
NBP1-87466
Immunocytochemistry/Immunofluorescence: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human dissociated rat hippocampal culture. Image courtesy of Janosch Heller, University College London.
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human cerebral cortex shows high expression.
(1 Review)
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP) (0)

There are no publications for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP) (0)

There are no reviews for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP)

Discover related pathways, diseases and genes to gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP)

Discover more about diseases related to gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP).
 

Pathways for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP)

View related products by pathway.

Blogs on gtf3c3

There are no specific blogs for gtf3c3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human gtf3c3 Protein
H00009330-Q01-10ug
SOX2 was detected in immersion fixed BG01V human embryonic stem cells using Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
SOX2 Antibody (245610) [Unconjugated]
MAB2018
Western Blot: gtf3c3 Antibody (2D8) [H00009330-M01] - GTF3C3 monoclonal antibody (M01), clone 2D8. Analysis of GTF3C3 expression in Raw 264.7.
gtf3c3 Antibody (2D8)
H00009330-M01-100ug
Western Blot: active/cleaved Caspase 8 Antibody [NB100-56116] - Analysis of active/cleaved Caspase 8 in NRK whole cell lysate using anti-active/cleaved Caspase 8 antibody. Image from verified customer review.
Caspase-8 Antibody - (active/cleaved)
NB100-56116

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our gtf3c3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GTF3C3