gtf3c3 Recombinant Protein Antigen

Images

 
There are currently no images for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

gtf3c3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human gtf3c3.

Source: E. coli

Amino Acid Sequence: RETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPTNVRYLWERSSLYEQMGD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GTF3C3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56032.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for gtf3c3 Recombinant Protein Antigen

  • general transcription factor 3C polypeptide 3
  • general transcription factor IIIC, polypeptide 3, 102kDa
  • TF3C-gamma
  • TFIIIC 102 kDa subunit
  • TFIIIC102general transcription factor IIIC, polypeptide 3 (102kD)
  • TFiiiC2-102
  • TFIIICgamma
  • Transcription factor IIIC 102 kDa subunit
  • Transcription factor IIIC subunit gamma
  • transcription factor IIIC, 102 kD

Background

General transcription factor 3C polypeptide 3 (GTF3C3/TFIIIC102) is a subunit of the TFIIIC DNA-binding factor required for transcription of tRNA and 5S rRNA genes by RNA polymerase III. Human TFIIIC is composed of six subunits: TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, and TFIIIC35. GTF3C3/TFIIIC102 appears to be important for stable complex formation and recruitment of RNA polymerase III by interacting with TFIIIB90, TBP, and TFIIIC63. GTF3C3/TFIIIC102 has been shown to also interact with DEDD and FLAME-3 proteins. This interaction may function to translocate GTF3C3/TFIIIC102 to the nucleus and regulate TFIIIC activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-60657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP (-), WB
NB100-56137
Species: Bv, Ca, Hu, Pm, Rt
Applications: IHC,  IHC-P, IP, WB
AF821
Species: Hu, Mu
Applications: WB
NB100-56125
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-31686
Species: Hu, Mu
Applications: ICC/IF, WB
NBP3-15951
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
H00009360-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-84610
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
NB100-567
Species: Hu
Applications: IHC,  IHC-P, IP, Simple Western, WB
NBP1-89306
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NBP2-22152
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, WB
NBP1-87466
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-56032PEP
Species: Hu
Applications: AC

Publications for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP) (0)

There are no publications for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP) (0)

There are no reviews for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for gtf3c3 Recombinant Protein Antigen (NBP2-56032PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional gtf3c3 Products

Blogs on gtf3c3

There are no specific blogs for gtf3c3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our gtf3c3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF3C3