GSTO2 Antibody

Images

 
Western Blot: GSTO2 Antibody [NBP2-14075] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: GSTO2 Antibody [NBP2-14075] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human prostate shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GSTO2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNP NAFDFG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GSTO2 Protein (NBP2-14075PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GSTO2 Antibody

  • bA127L20.1 (novel glutathione-S-transferase)
  • bA127L20.1
  • EC 2.5.1.18
  • glutathione S-transferase omega 2
  • glutathione S-transferase omega-2
  • glutathione-S-transferase-like protein
  • GSTO-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009446-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NB100-1131
Species: Hu, ArHa
Applications: WB, IHC, IHC-P, PEP-ELISA
AF6486
Species: Hu
Applications: WB, Simple Western
NBP1-33586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-55515
Species: Hu
Applications: ICC/IF
H00001646-M03
Species: Hu
Applications: WB, ELISA
H00002954-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF

Publications for GSTO2 Antibody (NBP2-14075) (0)

There are no publications for GSTO2 Antibody (NBP2-14075).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTO2 Antibody (NBP2-14075) (0)

There are no reviews for GSTO2 Antibody (NBP2-14075). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GSTO2 Antibody (NBP2-14075) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTO2 Products

Bioinformatics Tool for GSTO2 Antibody (NBP2-14075)

Discover related pathways, diseases and genes to GSTO2 Antibody (NBP2-14075). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTO2 Antibody (NBP2-14075)

Discover more about diseases related to GSTO2 Antibody (NBP2-14075).
 

Pathways for GSTO2 Antibody (NBP2-14075)

View related products by pathway.

PTMs for GSTO2 Antibody (NBP2-14075)

Learn more about PTMs related to GSTO2 Antibody (NBP2-14075).

Blogs on GSTO2

There are no specific blogs for GSTO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTO2