GRWD1 Antibody

Images

 
Independent Antibodies: Western Blot: GRWD1 Antibody [NBP2-56888] - Analysis using Anti-GRWD1 antibody NBP2-56888 (A) shows similar pattern to independent antibody NBP1-81790 (B).
Immunocytochemistry/ Immunofluorescence: GRWD1 Antibody [NBP2-56888] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

GRWD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WSPTENTVFASCSADASIRIWDIRAAPSKACMLTTATAHDGDVNVISWSRREPFLLSGGDDGALKIWDLRQFKSGSP
Specificity
Specificity of human GRWD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRWD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRWD1 Recombinant Protein Antigen (NBP2-56888PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GRWD1 Antibody

  • CDW4
  • CUL4- and DDB1-associated WDR protein 4
  • glutamate-rich WD repeat containing 1
  • GRWDglutamate rich WD repeat protein GRWD
  • KIAA1942regulator of ribosome biogenesis 1 homolog
  • RRB1
  • WD repeat domain 28
  • WDR28glutamate-rich WD repeat-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00023594-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-21389
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61646
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP3-03399
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP2-67899
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-55310
Species: Hu, Mu
Applications: WB, IP
NBP1-31308
Species: Hu, Mu, Rt, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49142
Species: Hu
Applications: WB, IHC, IHC-P, KD
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2567
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for GRWD1 Antibody (NBP2-56888) (0)

There are no publications for GRWD1 Antibody (NBP2-56888).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRWD1 Antibody (NBP2-56888) (0)

There are no reviews for GRWD1 Antibody (NBP2-56888). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRWD1 Antibody (NBP2-56888) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GRWD1 Products

Bioinformatics Tool for GRWD1 Antibody (NBP2-56888)

Discover related pathways, diseases and genes to GRWD1 Antibody (NBP2-56888). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRWD1 Antibody (NBP2-56888)

Discover more about diseases related to GRWD1 Antibody (NBP2-56888).
 

Pathways for GRWD1 Antibody (NBP2-56888)

View related products by pathway.

Blogs on GRWD1

There are no specific blogs for GRWD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRWD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRWD1