GRP78/HSPA5 Antibody - BSA Free

Images

 
Staining of human appendix shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Independent Antibodies: Western Blot: GRP78/HSPA5 Antibody [NBP1-89968] - Analysis using Anti-HSPA5 antibody NBP1-89968 (A) shows similar pattern to independent antibody NBP1-89969 (B).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
 

Independent Antibodies

       

Order Details

GRP78/HSPA5 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit GRP78/HSPA5 Antibody - BSA Free (NBP1-89968) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAK
Marker
ER Stress Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPA5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GRP78/HSPA5 Protein (NBP1-89968PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GRP78/HSPA5 Antibody - BSA Free

  • 78 kDa glucose-regulated protein
  • BIP
  • Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78
  • FLJ26106
  • GRP78
  • GRP-78
  • GRP78BIP
  • Heat shock 70 kDa protein 5
  • heat shock 70kD protein 5 (glucose-regulated protein, 78kD)
  • heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)
  • HSP70-5
  • HSPA5
  • Immunoglobulin heavy chain-binding protein
  • MIF2

Background

Within the ER, misfolded proteins are detected by Bip (GPR78). In the presence of misfolded proteins, GPR78 disscociates from PERK, allowing it to homodimerize and autophosphoyate. In its dimerized phosphorylated form, PERK phosphorylates eIF2. The phosphorylation of eIF2 blocks the majority of translation to prevent the continued accumulation of protein in the ER. GRP78 also binds to IRE1 and ATF6 under normal ER conditions, but dissociates upon accumulation of misfolded proteins. Unbound ATF6 is translocated to the gogli where it is converted into a cleaved, active form. The cleaved form of ATF6 is then able to up regulate transcription of UPR genes including XBP1. Activated IRE1 acts as an endoribonuclease to an intron from XBP1 transcripts. The XBP1 splice variant codes for an active transcription factor which activates transcription of P58IPK. P58IPK is a HSP40 protein which binds to and inhibits PERK. Thus, if the accumulated misfolded proteins have been removed, P58IPK acts to shut down the UPR by removing the block to translation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, Simple Western, WB
NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
AF3999
Species: Hu
Applications: KO, WB
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-76801
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-2323
Species: Dr, Gt, SyHa, Hu, Ma, Pm, Mu, Po, Pm, Rb, Rt
Applications: ChIP, ELISA, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, Simple Western, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-49086
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-852
Species: Hu, Mu
Applications: PEP-ELISA, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NBP1-89968
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for GRP78/HSPA5 Antibody (NBP1-89968) (0)

There are no publications for GRP78/HSPA5 Antibody (NBP1-89968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRP78/HSPA5 Antibody (NBP1-89968) (0)

There are no reviews for GRP78/HSPA5 Antibody (NBP1-89968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRP78/HSPA5 Antibody (NBP1-89968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRP78/HSPA5 Products

Research Areas for GRP78/HSPA5 Antibody (NBP1-89968)

Find related products by research area.

Blogs on GRP78/HSPA5.

GRP78 - molecular chaperone and negative regulator of the unfolded protein response
The 78 kDa glucose-regulated protein (GRP78) is the eukaryotic orthologue to the prokaryotic heat shock 70 kDa protein 5 (HSPA5). GRP78 is also sometimes referred to as BiP. GRP78 is a member of the HSP70 family and plays dynamic roles in protein ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRP78/HSPA5 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPA5