GRP78/HSPA5 Antibody


Western Blot: GRP78/HSPA5 Antibody [NBP1-89968] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: GRP78/HSPA5 Antibody [NBP1-89968] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GRP78/HSPA5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAK
ER Stress Marker
Specificity of human, mouse, rat GRP78/HSPA5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GRP78/HSPA5 Protein (NBP1-89968PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GRP78/HSPA5 Antibody

  • 78 kDa glucose-regulated protein
  • BIP
  • Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78
  • FLJ26106
  • GRP78
  • GRP-78
  • GRP78BIP
  • Heat shock 70 kDa protein 5
  • heat shock 70kD protein 5 (glucose-regulated protein, 78kD)
  • heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)
  • HSP70-5
  • HSPA5
  • Immunoglobulin heavy chain-binding protein
  • MIF2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GRP78/HSPA5 Antibody (NBP1-89968) (0)

There are no publications for GRP78/HSPA5 Antibody (NBP1-89968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRP78/HSPA5 Antibody (NBP1-89968) (0)

There are no reviews for GRP78/HSPA5 Antibody (NBP1-89968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRP78/HSPA5 Antibody (NBP1-89968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GRP78/HSPA5 Products

Bioinformatics Tool for GRP78/HSPA5 Antibody (NBP1-89968)

Discover related pathways, diseases and genes to GRP78/HSPA5 Antibody (NBP1-89968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRP78/HSPA5 Antibody (NBP1-89968)

Discover more about diseases related to GRP78/HSPA5 Antibody (NBP1-89968).

Pathways for GRP78/HSPA5 Antibody (NBP1-89968)

View related products by pathway.

PTMs for GRP78/HSPA5 Antibody (NBP1-89968)

Learn more about PTMs related to GRP78/HSPA5 Antibody (NBP1-89968).

Research Areas for GRP78/HSPA5 Antibody (NBP1-89968)

Find related products by research area.

Blogs on GRP78/HSPA5.

GRP78 - molecular chaperone and negative regulator of the unfolded protein response
The 78 kDa glucose-regulated protein (GRP78) is the eukaryotic orthologue to the prokaryotic heat shock 70 kDa protein 5 (HSPA5). GRP78 is also sometimes referred to as BiP. GRP78 is a member of the HSP70 family and plays dynamic roles in protein...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GRP78/HSPA5 Antibody and receive a gift card or discount.


Gene Symbol HSPA5