GRP78/HSPA5 Antibody - BSA Free

Western Blot: GRP78/HSPA5 Antibody [NBP1-89968] - Analysis using Anti-HSPA5 antibody NBP1-89968 (A) shows similar pattern to independent antibody NBP1-89969 (B).

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Western Blot: GRP78/HSPA5 Antibody [NBP1-89968] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRP78/HSPA5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAK
• Marker: ER Stress Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSPA5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GRP78/HSPA5 Protein (NBP1-89968PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GRP78/HSPA5 Antibody - BSA Free

• 78 kDa glucose-regulated protein
• BIP
• Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78
• FLJ26106
• GRP78
• GRP-78
• GRP78BIP
• Heat shock 70 kDa protein 5
• heat shock 70kD protein 5 (glucose-regulated protein, 78kD)
• heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)
• HSP70-5
• HSPA5
• Immunoglobulin heavy chain-binding protein
• MIF2

Background

Within the ER, misfolded proteins are detected by Bip (GPR78). In the presence of misfolded proteins, GPR78 disscociates from PERK, allowing it to homodimerize and autophosphoyate. In its dimerized phosphorylated form, PERK phosphorylates eIF2. The phosphorylation of eIF2 blocks the majority of translation to prevent the continued accumulation of protein in the ER. GRP78 also binds to IRE1 and ATF6 under normal ER conditions, but dissociates upon accumulation of misfolded proteins. Unbound ATF6 is translocated to the gogli where it is converted into a cleaved, active form. The cleaved form of ATF6 is then able to up regulate transcription of UPR genes including XBP1. Activated IRE1 acts as an endoribonuclease to an intron from XBP1 transcripts. The XBP1 splice variant codes for an active transcription factor which activates transcription of P58IPK. P58IPK is a HSP40 protein which binds to and inhibits PERK. Thus, if the accumulated misfolded proteins have been removed, P58IPK acts to shut down the UPR by removing the block to translation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSPA5