GRP75/HSPA9B/Mortalin Antibody - BSA Free

Western Blot: GRP75/HSPA9B/Mortalin Antibody [NBP1-89729] - Analysis in human cell line CACO-2.

Immunocytochemistry/Immunofluorescence: GRP75/HSPA9B/Mortalin Antibody [NBP1-89729] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GRP75/HSPA9B/Mortalin Antibody [NBP1-89729] - Staining of human cerebral cortex shows strong positivity in mitochondria in neurons.

Western Blot: GRP75/HSPA9B/Mortalin Antibody [NBP1-89729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: GRP75/HSPA9B/Mortalin Antibody [NBP1-89729] - Staining of human colon shows strong positivity in mitochondria in glandular cells.

Immunohistochemistry-Paraffin: GRP75/HSPA9B/Mortalin Antibody [NBP1-89729] - Staining of human liver shows strong positivity in mitochondria in hepatocytes.

Immunohistochemistry-Paraffin: GRP75/HSPA9B/Mortalin Antibody [NBP1-89729] - Staining of human kidney shows strong positivity in mitochondria in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRP75/HSPA9B/Mortalin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGT
• Marker: Immortalization Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSPA9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GRP75/HSPA9B/Mortalin Protein (NBP1-89729PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25379943).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GRP75/HSPA9B/Mortalin Antibody - BSA Free

• 75 kDa glucose-regulated protein
• CSA
• GRP75
• GRP-75
• GRP75mthsp75
• Heat shock 70 kDa protein 9
• heat shock 70kD protein 9B
• heat shock 70kDa protein 9 (mortalin)
• heat shock 70kDa protein 9B (mortalin-2)
• HSPA9
• HSPA9B
• HSPA9BMGC4500
• Mortalin
• mortalin, perinuclear
• Mortalin-2
• MOT
• MOT2
• mot-2
• MTHSP75
• p66-mortalin
• PBP74
• PBP74CSA
• Peptide-binding protein 74
• stress-70 protein, mitochondrial

Background

The HSP 70 family comprises four highly conserved proteins, HSP 70, HSC 70, GRP 75 and GRP 78, which serve a variety of roles. They act as molecular chaperones facilitating the assembly of multi-protein complexes, participate in the translocation of polypeptides across cell membranes and to the nucleus, and aid in the proper folding of nascent polypeptide chains. HSC 70, GRP 75 and GRP 78 are constitutively expressed in primate cells. HSP 70 expression is strongly induced in response to heat stress. HSP 70 and HSC 70, which are found in both the cytosol and nucleus of mammalian cells, play key roles in the cytosolic endoplasmic reticulum and mitochondrial import machinery. They are involved in chaperoning nascent polypeptide chains and in protecting cells against the accumulation of improperly folded proteins. GRP 75 and GRP 78 are unresponsive to heat stress and are induced by glucose deprivation. GRP 75 expression is restricted to the mitochondrial matrix and aids in the translocation and folding of nascent polypeptide chains of both nuclear and mitochondrial origin. GRP 78 is localized in the endoplasmic reticulum, where it receives imported secretory proteins and is involved in the folding and translocation of nascent peptide chains. Research indicates that members of the HSP 70 family may act as force-generating motors, relying on the hydrolysis of ATP for their activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRP75/HSPA9B/Mortalin Antibody (NBP1-89729)(1)

Publication using NBP1-89729

• Morisaki T, Yashiro M, Kakehashi A, et al. Comparative Proteomics Analysis of Gastric Cancer Stem Cells PLos One. 2014-11-07 [PMID: 25379943] (IF/IHC, Human)
  
  Details:
  Chorein/VPS13A antibody used for IHC- P at 1:500 dilution on gastric cancer tissue specimens - antigen retrieval for 10 minutes at 105C by autoclave in Target Retrieval Solution, endogenous peroxidase blocked with 3%H2O2, On/4C incubation for primary, streptavidin-peroxidase-DAB detection (Figure 3).

Bioinformatics

• Gene Symbol: HSPA9