GRP75/HSPA9B/Mortalin Antibody

Images

 
Western Blot: GRP75/HSPA9B/Mortalin Antibody [NBP1-89729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: GRP75/HSPA9B/Mortalin Antibody [NBP1-89729] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: GRP75/HSPA9B/Mortalin Antibody [NBP1-89729] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Western Blot: GRP75/HSPA9B/Mortalin Antibody [NBP1-89729] - Analysis in human cell line CACO-2.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRP75/HSPA9B/Mortalin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGT
Marker
Immortalization Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPA9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRP75/HSPA9B/Mortalin Protein (NBP1-89729PEP)
Publications
Read Publication using
NBP1-89729 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25379943).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRP75/HSPA9B/Mortalin Antibody

  • 75 kDa glucose-regulated protein
  • CSA
  • GRP75
  • GRP-75
  • GRP75mthsp75
  • Heat shock 70 kDa protein 9
  • heat shock 70kD protein 9B
  • heat shock 70kDa protein 9 (mortalin)
  • heat shock 70kDa protein 9B (mortalin-2)
  • HSPA9
  • HSPA9B
  • HSPA9BMGC4500
  • Mortalin
  • mortalin, perinuclear
  • Mortalin-2
  • MOT
  • MOT2
  • mot-2
  • MTHSP75
  • p66-mortalin
  • PBP74
  • PBP74CSA
  • Peptide-binding protein 74
  • stress-70 protein, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-61070
Species: Hu
Applications: WB (-), IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GRP75/HSPA9B/Mortalin Antibody (NBP1-89729)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GRP75/HSPA9B/Mortalin Antibody (NBP1-89729) (0)

There are no reviews for GRP75/HSPA9B/Mortalin Antibody (NBP1-89729). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRP75/HSPA9B/Mortalin Antibody (NBP1-89729) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRP75/HSPA9B/Mortalin Products

Bioinformatics Tool for GRP75/HSPA9B/Mortalin Antibody (NBP1-89729)

Discover related pathways, diseases and genes to GRP75/HSPA9B/Mortalin Antibody (NBP1-89729). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRP75/HSPA9B/Mortalin Antibody (NBP1-89729)

Discover more about diseases related to GRP75/HSPA9B/Mortalin Antibody (NBP1-89729).
 

Pathways for GRP75/HSPA9B/Mortalin Antibody (NBP1-89729)

View related products by pathway.

PTMs for GRP75/HSPA9B/Mortalin Antibody (NBP1-89729)

Learn more about PTMs related to GRP75/HSPA9B/Mortalin Antibody (NBP1-89729).
 

Research Areas for GRP75/HSPA9B/Mortalin Antibody (NBP1-89729)

Find related products by research area.

Blogs on GRP75/HSPA9B/Mortalin

There are no specific blogs for GRP75/HSPA9B/Mortalin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRP75/HSPA9B/Mortalin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPA9
Entrez