GRHPR Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GRHPR Antibody [NBP1-83359] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Staining of human kidney shows weak granular cytoplasmic positivity in cells in tubules.

Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Analysis in human cell line A-549.

Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.

Staining of human placenta shows very weak positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRHPR Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRHPR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GRHPR Protein (NBP1-83359PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GRHPR Antibody - BSA Free

• EC 1.1.1.81
• GLXREC 1.1.1.79
• glycerate-2-dehydrogenase
• GLYD
• glyoxylate reductase/hydroxypyruvate reductase
• PH2

Background

GRHPR encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRHPR