GRHPR Antibody

Images

 
Western Blot: GRHPR Antibody [NBP1-83359] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: GRHPR Antibody [NBP1-83359] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: GRHPR Antibody [NBP1-83359] - Staining of human gall bladder shows moderate cytoplasmic and membranous positivity in glandular cells.
Western Blot: GRHPR Antibody [NBP1-83359] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRHPR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRHPR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRHPR Protein (NBP1-83359PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRHPR Antibody

  • EC 1.1.1.81
  • GLXREC 1.1.1.79
  • glycerate-2-dehydrogenase
  • GLYD
  • glyoxylate reductase/hydroxypyruvate reductase
  • PH2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84896
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GRHPR Antibody (NBP1-83359) (0)

There are no publications for GRHPR Antibody (NBP1-83359).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRHPR Antibody (NBP1-83359) (0)

There are no reviews for GRHPR Antibody (NBP1-83359). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRHPR Antibody (NBP1-83359) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRHPR Products

Bioinformatics Tool for GRHPR Antibody (NBP1-83359)

Discover related pathways, diseases and genes to GRHPR Antibody (NBP1-83359). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRHPR Antibody (NBP1-83359)

Discover more about diseases related to GRHPR Antibody (NBP1-83359).
 

Pathways for GRHPR Antibody (NBP1-83359)

View related products by pathway.

PTMs for GRHPR Antibody (NBP1-83359)

Learn more about PTMs related to GRHPR Antibody (NBP1-83359).

Blogs on GRHPR

There are no specific blogs for GRHPR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRHPR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRHPR