GREB1 Antibody

Images

 
Western Blot: GREB1 Antibody [NBP3-10496] - Western blot analysis of GREB1 in Human heart. Antibody dilution at 1 ug/mL

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GREB1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GREB1 (NP_149081). Peptide sequence IFSQLYLEAEQQLAALEGGSRVDNEEEEEEGEGGLETNGPPNPFQLHPLP
Clonality
Polyclonal
Host
Rabbit
Gene
GREB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for GREB1 Antibody

  • gene regulated by estrogen in breast cancer protein
  • growth regulation by estrogen in breast cancer 1
  • KIAA0575Gene regulated in breast cancer 1 protein
  • protein GREB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP1-90813
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-314
Species: Hu
Applications: IP, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-2289
Species: Gp, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-27196
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC, IHC-P, KD, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-305
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: CHIP-SEQ, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
H00003208-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-95122
Species: Hu, Mu, Rt
Applications: IP, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
DY262
Species: Hu
Applications: ELISA
DKK300
Species: Hu
Applications: ELISA

Publications for GREB1 Antibody (NBP3-10496) (0)

There are no publications for GREB1 Antibody (NBP3-10496).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GREB1 Antibody (NBP3-10496) (0)

There are no reviews for GREB1 Antibody (NBP3-10496). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GREB1 Antibody (NBP3-10496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GREB1 Products

Array NBP3-10496

Bioinformatics Tool for GREB1 Antibody (NBP3-10496)

Discover related pathways, diseases and genes to GREB1 Antibody (NBP3-10496). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GREB1 Antibody (NBP3-10496)

Discover more about diseases related to GREB1 Antibody (NBP3-10496).
 

Pathways for GREB1 Antibody (NBP3-10496)

View related products by pathway.

PTMs for GREB1 Antibody (NBP3-10496)

Learn more about PTMs related to GREB1 Antibody (NBP3-10496).

Blogs on GREB1

There are no specific blogs for GREB1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GREB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GREB1