Home » GREB1 » GREB1 Antibodies » GREB1 Antibody

GREB1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: GREB1 Antibody [NBP3-10496] - Western blot analysis of GREB1 in Human heart. Antibody dilution at 1 ug/mL
Western Blot: GREB1 Antibody [NBP3-10496] - Western blot analysis of GREB1 in Human heart. Antibody dilution at 1 ug/mL

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GREB1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GREB1 (NP_149081). Peptide sequence IFSQLYLEAEQQLAALEGGSRVDNEEEEEEGEGGLETNGPPNPFQLHPLP
Clonality
Polyclonal
Host
Rabbit
Gene
GREB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for GREB1 Antibody

  • gene regulated by estrogen in breast cancer protein
  • growth regulation by estrogen in breast cancer 1
  • KIAA0575Gene regulated in breast cancer 1 protein
  • protein GREB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(8 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
TFF1/pS2 Antibody
NBP1-90813
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human stomach shows high expression.
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining in human stomach and liver tissues using anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the same tissues.
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
DBT Antibody
NBP1-89522
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human pancreas shows weak to moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Presenilin-2
Antibody (APS 26)
NB100-74513
Immunocytochemistry/Immunofluorescence: Presenilin-2 Antibody (APS 26) [NB100-74513] - Staining of mouse fibroblasts.
Immunocytochemistry/Immunofluorescence: Presenilin-2 Antibody (APS 26) [NB100-74513] - Analysis of Presenilin 2 using Anti-Presenilin 2 Monoclonal Antibody (APS 26) shows staining in A2058 Cells. Presenilin 2 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Presenilin 2 at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Presenilin-2 Antibody (APS 26) [NB100-74513] - Presenilin 2 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Presenilin 2 at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NCOA3/AIB1 Antibody
NB100-314
Western Blot: NCOA3/AIB1 Antibody [NB100-314] - Nuclear extract (5 mcg for WB, 10 mg for CoIP) from HeLa cells. Affinity purified rabbit anti-SRC3 used at 0.33 mcg/ml for WB and 20 mcg/10 mg extract for CoIP.
Western Blot: NCOA3/AIB1 Antibody [NB100-314] - Detection of Human SRC3 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SRC3 antibody NB100-314 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(1 Review)
(4 Publications)
Species: Hu
Applications: IP, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Progesterone R/NR3C3 was detected in immersion fixed T47D human breast cancer cell line using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Progesterone R/NR3C3 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of T47D human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) followed by HRP‑conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for PR-A and PR-B at approximately 90 and 118 kDa, respectively (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AHR Antibody - BSA
Free
NB100-2289
Immunocytochemistry/Immunofluorescence: AHR Antibody [NB100-2289] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-AHR at 5 ug/mL overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: AHR Antibody [NB100-2289] - An intracellular stain was performed on U-87 cells with AHR Antibody NB100-2289B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Knockdown Validated: AHR Antibody [NB100-2289] - Activation of AHR/Nrf2 pathway by PFT-alpha. Knock-down efficiency of AHR siRNA as detected by qPCR (upper part) and western blot (lower part). Relative expression level is shown as fold change normalized to scramble siRNA. All values represent the mean +/- SD of two independent experiments performed in three replicates. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-020-58051-1), licensed under a CC-BY licence.
(2 Reviews)
(7 Publications)
Species: Gp, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
LRH-1/NR5A2
Antibody
NBP2-27196
Immunohistochemistry-Paraffin: LRH-1/NR5A2 Antibody [NBP2-27196] - Analysis of NR5A2/LRH1 in human pancreas tissue using NR5A2/LRH1 antibody at 5 ug/ml.
Western Blot: LRH-1/NR5A2 Antibody [NBP2-27196] - Analysis of NR5A2 in HEPG2 lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse NIH3T3 and 4) RAW lysate probed with 3 ug/ml of NR5A2 antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(1 Publication)
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC, IHC-P, KD, WB
Aromatase Antibody
NB100-1596
Western Blot: Aromatase Antibody [NB100-1596] - Detection of aromatase in human fetal temporal lobe lysate using NB 100-1596. ECL exposure, 1-2 minutes.
Western Blot: Aromatase Antibody [NB100-1596] - Expression of the cytochrome P450 aromatase in the ovary of control (C; open bar; n = 6) and hypothyroid (Hypo; solid bar; n = 6) rabbits. Representative immunoblot showing the expression of aromatase. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/bmri/2017/3795950/), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Aromatase Antibody [NB100-1596] - Expression of the cytochrome P450 aromatase in the ovary of hypothyroid (Hypo; solid bar; n = 6) rabbits. Immunoreactivity of antiaromatase (+) was identified in granulosa cells of antral follicles (tertiary, tf; Graafian, gf) of hypothyroid ovaries. Nonlabeling was observed when the primary antibody was omitted. Bars: 100 um (1st image); and 20 um (2nd image). Granulose cells, gc; theca cells, tc. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/bmri/2017/3795950/), licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot: Cyclin D1 Antibody (SPM587) [NBP2-32840] - HELLS expression and protein levels are modulated with YAP1/TEAD inhibition downstream of SHH signaling. Western blot showing protein levels of HELLS, cleaved caspase 3 (CC3), and Cyclin D1 in verteporfin treated CGNPs. Blot is representative of three replicates. Full-length blots are presented in Supplementary Fig. S4. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-50088-1), licensed under a CC-BY licence.
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on Jurkat cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on MCF-7 cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
(1 Review)
(7 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ER beta/NR3A2
Antibody (14C8)
NB200-305
Immunohistochemistry-Paraffin: ER beta/NR3A2 Antibody (14C8) [NB200-305] - Human breast carcinoma. Estrogen Receptor beta stained by Estrogen Receptor beta antibody [14C8] diluted at 1:200. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: Estrogen Receptor beta Antibody (14C8) [NB200-305] - Infiltrating lobular carcinoma of the breast.
Western Blot: ER beta/NR3A2 Antibody (14C8) [NB200-305] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with Estrogen Receptor beta antibody [14C8] diluted at 1:5000. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody
(75 Publications)
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(38 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
ARNT/HIF-1 beta
Antibody (H1beta234) ...
NB100-124
Western Blot: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - Western Blot analysis with ARNT/HIF-1 beta antibody (H1beta234) [NB100-124], theoretical molecular weight 86.6 kDa. Expression of CD44 mRNA in genetically engineered MDA-MB-231 cells. (A) Immunoblot analysis of HIF-1A or HIF-2A expression in whole cell extracts from MDA-MB-231 cells stably expressing EV, HIF-1A-shRNA or HIF-2A-shRNA under normoxia or in response to 4 h treatment with 200 uM CoCl2. HIF-1B expression was used as a loading control. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0044078) licensed under a CC-BY licence.
Western Blot: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - HIF was not the only factor stabilizing activated EGFR in VHL-deficient ccRCC cells. A. Western blot analysis of 786-VHL and 786-mock cells stably expressing shRNA constructs. For HIF2A (NB100-480) and ARNT/HIF-1 beta antibody (H1beta234)[NB100-124] analysis, nuclear extracts were generated and analyzed. Anti-HA blot detected HA-VHL. Means and SDs of three separate experiments were shown. Theoretical molecular weight for ARNT/HIF-1 beta is 86.6 kDa, observed molecular weight ~90 kDa. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0023936) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - Co-localization of HIF-2alpha with ARNT/HIF-1 beta antibody (H1beta234) [NB100-124]. ICC/IF detecting indicated proteins using antibodies labelled with Alexa Fluor 555 (red, pseudocolour) and Alexa Fluor 488 (green, pseudocolour). 'Merge' is the red image superimposed onto the green image of the co-stained nuclear proteins. 'Coloc' is the co-localization channel calculated using ImageJ plugin. White indicates pixels where both red and green signal is found (i.e. co-localization). 'Overlay' is the co-localization image superimposed onto the merged image. Inlay is the magnified region (white square). White arrows highlight regions of co-localization. Scale bar, 5 um. Abbreviations: RNAPII, RNA Polymerase II phospho-serine 5. Image collected and cropped by CiteAb from the following publication (http://rsob.royalsocietypublishing.org/lookup/doi/10.1098/rsob.160195), licensed under a CC-BY licence.
(4 Reviews)
(99 Publications)
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: CHIP-SEQ, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
Hippocalcin
Antibody
H00003208-B01P
Western Blot: Hippocalcin Antibody [H00003208-B01P] - Analysis of HPCA expression in transfected 293T cell line by HPCA polyclonal antibody. Lane 1: HPCA transfected lysate(21.23 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: Hippocalcin Antibody [H00003208-B01P] - Analysis of purified antibody to HPCA on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: ICC/IF, WB
VILIP3 Antibody
NBP2-95122
Western Blot: VILIP3 Antibody [NBP2-95122] - Analysis of extracts of various cell lines, using VILIP3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.
Western Blot: VILIP3 Antibody [NBP2-95122] - Analysis of extracts of HepG2 cells using VILIP3 at a dilition of 1:1000.
Species: Hu, Mu, Rt
Applications: IP, WB
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ChIP, IP, WB
Amphiregulin
[Biotin]
DY262
(1 Review)
(39 Publications)
Species: Hu
Applications: ELISA
Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(16 Publications)
Species: Hu
Applications: ELISA

Publications for GREB1 Antibody (NBP3-10496) (0)

There are no publications for GREB1 Antibody (NBP3-10496).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GREB1 Antibody (NBP3-10496) (0)

There are no reviews for GREB1 Antibody (NBP3-10496). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GREB1 Antibody (NBP3-10496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GREB1 Products

Array NBP3-10496

Bioinformatics Tool for GREB1 Antibody (NBP3-10496)

Discover related pathways, diseases and genes to GREB1 Antibody (NBP3-10496). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GREB1 Antibody (NBP3-10496)

Discover more about diseases related to GREB1 Antibody (NBP3-10496).
 

Pathways for GREB1 Antibody (NBP3-10496)

View related products by pathway.

PTMs for GREB1 Antibody (NBP3-10496)

Learn more about PTMs related to GREB1 Antibody (NBP3-10496).

Blogs on GREB1

There are no specific blogs for GREB1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GREB1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GREB1