Hippocalcin Antibody

Images

 
Western Blot: Hippocalcin Antibody [H00003208-B01P] - Analysis of HPCA expression in transfected 293T cell line by HPCA polyclonal antibody. Lane 1: HPCA transfected lysate(21.23 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: Hippocalcin Antibody [H00003208-B01P] - Analysis of purified antibody to HPCA on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Hippocalcin Antibody Summary

Immunogen
HPCA (NP_002134, 1 a.a. - 193 a.a.) full-length human protein. MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSPGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSRSQF
Specificity
HPCA - hippocalcin,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HPCA
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hippocalcin Antibody

  • BDR2
  • Calcium-binding protein BDR-2
  • hippocalcin
  • neuron specific calcium-binding protein hippocalcin
  • neuron-specific calcium-binding protein hippocalcin

Background

The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. This protein is associated with the plasma membrane. It has similarities to proteins located in the photoreceptor cells that regulate photosignal transduction in a calcium-sensitive manner. This protein displays recoverin activity and a calcium-dependent inhibition of rhodopsin kinase. It is identical to the rat and mouse hippocalcin proteins and thought to play an important role in neurons of the central nervous system in a number of species. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB120-2776
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP2-25169
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P
MAB829
Species: Hu
Applications: WB, IHC
H00003208-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for Hippocalcin Antibody (H00003208-B01P) (0)

There are no publications for Hippocalcin Antibody (H00003208-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hippocalcin Antibody (H00003208-B01P) (0)

There are no reviews for Hippocalcin Antibody (H00003208-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Hippocalcin Antibody (H00003208-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Hippocalcin Antibody (H00003208-B01P)

Discover related pathways, diseases and genes to Hippocalcin Antibody (H00003208-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hippocalcin Antibody (H00003208-B01P)

Discover more about diseases related to Hippocalcin Antibody (H00003208-B01P).
 

Pathways for Hippocalcin Antibody (H00003208-B01P)

View related products by pathway.

PTMs for Hippocalcin Antibody (H00003208-B01P)

Learn more about PTMs related to Hippocalcin Antibody (H00003208-B01P).

Blogs on Hippocalcin

There are no specific blogs for Hippocalcin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hippocalcin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HPCA
Entrez
Uniprot