GRB10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GRB10 Antibody [NBP2-55491] - Staining of human cell line A549 shows localization to nuclear membrane & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRB10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVS
Specificity
Specificity of human GRB10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRB10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GRB10 Antibody

  • GRB10 adapter protein
  • GRB10 adaptor protein
  • Grb-10
  • GRBIR
  • GRB-IR
  • growth factor receptor-bound protein 10
  • Insulin receptor-binding protein Grb-IR
  • IRBP
  • KIAA0207
  • maternally expressed gene 1
  • MEG1
  • RSS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58952
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74190
Species: Mu, Rt, Po, Eq
Applications: WB, ChIP
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-56853
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, ICC/IF, IHC
AF4856
Species: Hu, Mu, Rt
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-38230
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P

Publications for GRB10 Antibody (NBP2-55491) (0)

There are no publications for GRB10 Antibody (NBP2-55491).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRB10 Antibody (NBP2-55491) (0)

There are no reviews for GRB10 Antibody (NBP2-55491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GRB10 Antibody (NBP2-55491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GRB10 Products

Bioinformatics Tool for GRB10 Antibody (NBP2-55491)

Discover related pathways, diseases and genes to GRB10 Antibody (NBP2-55491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRB10 Antibody (NBP2-55491)

Discover more about diseases related to GRB10 Antibody (NBP2-55491).
 

Pathways for GRB10 Antibody (NBP2-55491)

View related products by pathway.

PTMs for GRB10 Antibody (NBP2-55491)

Learn more about PTMs related to GRB10 Antibody (NBP2-55491).
 

Research Areas for GRB10 Antibody (NBP2-55491)

Find related products by research area.

Blogs on GRB10

There are no specific blogs for GRB10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRB10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRB10