GRAP Antibody - BSA Free

Immunohistochemistry-Paraffin: GRAP Antibody [NBP1-91969] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and GRAP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRAP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GRAP Antibody - BSA Free (NBP1-91969) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ELVDFYRTTTIAKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDPHWWRGRSCGRVGFFPRSYVQPVHL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRAP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GRAP Protein (NBP1-91969PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GRAP Antibody - BSA Free

• GRB2-related adapter protein
• GRB2-related adaptor protein
• growth factor receptor-bound protein 2-related adaptor protein
• MGC64880

Background

GRAP is a member of the GRB2/Sem5/Drk family containing an SH2 domain flanked by two SH3 domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRAP