Granzyme H Antibody - BSA Free

Immunohistochemistry-Paraffin: Granzyme H Antibody [NBP1-86565] - Staining in human spleen and pancreas tissues using anti-GZMH antibody. Corresponding GZMH RNA-seq data are presented for the same tissues.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human tonsil shows strong granular cytoplasmic positivity in non-germinal center cells.

Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Staining of human spleen shows moderate granular positivity in cells in red pulp.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Granzyme H Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GZMH
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Granzyme H Protein (NBP1-86565PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Granzyme H Antibody - BSA Free

• Cathepsin G-like 2
• CCP-X
• CCP-Xcytotoxic T-lymphocyte-associated serine esterase 1
• CGL2
• CGL-2
• CSP-Ccytotoxin serine protease-C
• CTLA1
• CTSGL2
• CTSGL2granzyme H
• Cytotoxic serine protease C
• Cytotoxic T-lymphocyte proteinase
• EC 3.4.21
• EC 3.4.21.-
• EC 3.4.21.79
• granzyme H (cathepsin G-like 2, protein h-CCPX)
• Granzyme H
• GrzH
• GZMH

Background

The granzyme family of proteins belong to the larger peptidase S1 family. Granzyme A and granzyme B are serine proteases that facilitate apoptotic signaling in cytotoxic T lymphocytes (CTL) and natural killer (NK) cells. Within the granules of activated CTLs, granzyme A and granzyme B are processed and converted to their active forms by the lysosomal cysteine protease cathepsin C. Once cleaved, these active proteases target distinct substrates for proteolysis and, thereby, mediate apoptosis through two different pathways. Granzyme H, also designated cytotoxic T-lymphocyte proteinase, cathepsin G-like 2 (CTSGL2) or cytotoxic serine protease C (CSP-C), contains one peptidase S1 domain. Granzyme H localizes to cytoplasmic granules of cytolytic T-lymphocytes and is important for target cell lysis in cell-mediated immune responses.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GZMH
• Entrez:
  • 2999(Human)
• Uniprot:
  • P20718()