Recombinant Human Granulin GST (N-Term) Protein

Images

 
SDS-Page: Granulin Partial Recombinant Protein [H00002896-Q01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func, PA, AP

Order Details

Recombinant Human Granulin GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 494-593 of Human Granulin

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SCEKEVVSAQPATFLARSPHVAVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GRN
Purity
>10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00002896-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Granulin GST (N-Term) Protein

  • acrogranin
  • GEP
  • GP88
  • granulin
  • granulin-epithelin
  • granulins
  • PC cell-derived growth factor
  • PCDGF
  • PEPI
  • PGRN
  • proepithelin
  • progranulin

Background

GRN - granulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00023435-M01
Species: Hu, Mu, Rt, Ba, Pp, I, Pm
Applications: WB, ELISA, Func, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF7509
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-33950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-89781
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-88376
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
AF1436
Species: Mu
Applications: WB
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
7270-IL/CF
Species: Hu
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00002896-Q01
Species: Hu
Applications: WB, ELISA, Func, PA, AP

Publications for Granulin Partial Recombinant Protein (H00002896-Q01)(3)

Reviews for Granulin Partial Recombinant Protein (H00002896-Q01) (0)

There are no reviews for Granulin Partial Recombinant Protein (H00002896-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Granulin Partial Recombinant Protein (H00002896-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Granulin Products

Bioinformatics Tool for Granulin Partial Recombinant Protein (H00002896-Q01)

Discover related pathways, diseases and genes to Granulin Partial Recombinant Protein (H00002896-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granulin Partial Recombinant Protein (H00002896-Q01)

Discover more about diseases related to Granulin Partial Recombinant Protein (H00002896-Q01).
 

Pathways for Granulin Partial Recombinant Protein (H00002896-Q01)

View related products by pathway.

PTMs for Granulin Partial Recombinant Protein (H00002896-Q01)

Learn more about PTMs related to Granulin Partial Recombinant Protein (H00002896-Q01).
 

Research Areas for Granulin Partial Recombinant Protein (H00002896-Q01)

Find related products by research area.

Blogs on Granulin

There are no specific blogs for Granulin, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Granulin GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRN