GPRC5A/RAI3 Antibody - BSA Free

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Analysis in human lung and skeletal muscle tissues. Corresponding GPRC5A RNA-seq data are presented for the same tissues.

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Western Blot analysis of different pathways were tested for alteration in knock-down with GPRC5A siRNA in comparison to negative control. Phosphorylation of STAT3 at Tyr705 is reduced in knock-down of all three cell lines, whereas Phospho-ERK is not changed significantly (see S2 Fig for original Western blot images). (n = 3). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0170390), licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human cell line U-2 OS shows localization to nucleoli, plasma membrane & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human small intestine shows moderate positivity in apical membrane in glandular cells.

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - (J) RAI3 has a conspicuously low expression in BxPc3 and PaCaDD165 in comparison to the other cell lines in the group. (n = 3). (PLoS One. 2017; 12 (1): e0170390. Published online 2017 Jan 23.)

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Wester Blot: Pancreatic cell lines, where NC1 and NC2 represent negative controls.

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Analysis in human cell lines A-431 and U-251MG using anti-GPRC5A antibody. Corresponding GPRC5A RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

Immunohistochemistry Free-Floating: GPRC5A/RAI3 Antibody [NBP1-89743] - Expression of RAI3 in human tissue and cell lines. Immunochemistry with RAI3-Antibody in different types of pancreatic tissue. Presentation in 20-fold magnification of A-C: Normal; D: Chronic pancreatits (CP), E: Intraductal Papillary Mucinous Neoplasm (IPMN); F-H: Pancreatic Ductal Adenocarcinoma (PDAC). (PLoS One. 2017; 12 (1): e0170390. Published online 2017 Jan 23.)

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human lung shows moderate membranous positivity in pneumocytes.

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human urinary bladder shows moderate membranous positivity in urothelial cells.

Western Blot analysis of different pathways were tested for alteration in knock-down with GPRC5A siRNA in comparison to negative control.Phosphorylation of STAT3 at Tyr705 is reduced in knock-down of all three cell lines, whereas Phospho-ERK is not changed significantly (see S2 Fig for original Western blot images). (n = 3).

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - GPRC5a expression levels in normal pancreas & PaCa (PAAD) tissue & cell lines. (A,B) The data-mining analysis showed that GPRC5a was significantly upregulated in PaCa (PAAD) samples with an association of increased expression in higher malignant tumor stages (p < 0.05). (C,D) The Western blot & qPCR results showed that the basic protein-level expression of GPRC5a in PaCa cell lines was higher than that in the HPDEE6E7 pancreas cell line. (E) Immunofluorescence assay showed upregulated expression of GPRC5a in PaCa cell lines (200×). The error bars were from multiple samples (n) measurement results (A,B) or three experimental measurements (C,D). * p-value < 0.05. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29949874), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Influence of GPRC5a knockout on the proliferation & migration ability in MIA PaCa-2 & TB32047 cells. (A–D) Western blot & sequencing results showing the GPRC5a knocked out in MIA PaCa-2-KO1/2 & TB32047-KO1/2 (Red highlight area means the different part in comparison of sequencing sequence). (E,F): The knockout of GPRC5a inhibited the proliferation ability of MIA PaCa-2 & TB32047 cells. (G,H) GPRC5a knockout inhibited the migration ability of MIA PaCa-2 (G) & TB32047 cells (H). * p-value < 0.05. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29949874), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Influence of GPRC5a knockout on the proliferation & migration ability in MIA PaCa-2 & TB32047 cells. (A–D) Western blot & sequencing results showing the GPRC5a knocked out in MIA PaCa-2-KO1/2 & TB32047-KO1/2 (Red highlight area means the different part in comparison of sequencing sequence). (E,F): The knockout of GPRC5a inhibited the proliferation ability of MIA PaCa-2 & TB32047 cells. (G,H) GPRC5a knockout inhibited the migration ability of MIA PaCa-2 (G) & TB32047 cells (H). * p-value < 0.05. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29949874), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPRC5A/RAI3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPRC5A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry Free-Floating 1:1000 - 1:2500
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GPRC5A/RAI3 Protein (NBP1-89743PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPRC5A/RAI3 Antibody - BSA Free

• G protein-coupled receptor, family C, group 5, member A
• GPCR5A
• GPRC5A
• Orphan G-protein-coupling receptor PEIG-1
• RAI3
• RAI3G-protein coupled receptor family C group 5 member A
• RAIG1
• RAIG1RAIG-1
• retinoic acid induced 3
• retinoic acid responsive
• Retinoic acid-induced gene 1 protein
• retinoic acid-induced protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GPRC5A/RAI3 Antibody (NBP1-89743)(2)

Publications using NBP1-89743

• Liu B, Yang H, PilarskY C, Weber GF. The Effect of GPRC5a on the Proliferation, Migration Ability, Chemotherapy Resistance, and Phosphorylation of GSk-3B in Pancreatic Cancer. Int J Mol Sci. 2018-06-26 [PMID: 29949874] (ICC/IF, WB, Human)
• Jahny E, Yang H, Liu B et al. The G Protein-Coupled Receptor RAI3 Is an Independent Prognostic Factor for Pancreatic Cancer Survival and Regulates Proliferation via STAT3 Phosphorylation PLoS ONE 2017-01-23 [PMID: 28114355] (WB, Human)

Bioinformatics

• Gene Symbol: GPRC5A