GPRC5A/RAI3 Antibody

Images

 
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Analysis in human cell lines A-431 and U-251MG using Anti-GPRC5A antibody. Corresponding GPRC5A RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human cell line U-2 OS shows localization to nucleoli, plasma membrane & vesicles.
Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Analysis in control (vector only transfected HEK293T lysate) and GPRC5A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - (J) RAI3 has a conspicuously low expression in BxPc3 and PaCaDD165 in comparison to the other cell lines in the group. (n = 3). (PLoS One. 2017; 12 (1): e0170390. ...read more
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Wester Blot: Pancreatic cell lines, where NC1 and NC2 represent negative controls.
Immunohistochemistry Free-Floating: GPRC5A/RAI3 Antibody [NBP1-89743] - Expression of RAI3 in human tissue and cell lines. Immunochemistry with RAI3-Antibody in different types of pancreatic tissue. Presentation in ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IHC-FrFl
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

GPRC5A/RAI3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPRC5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Immunohistochemistry Free-Floating
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPRC5A/RAI3 Protein (NBP1-89743PEP)
Publications
Read Publication using
NBP1-89743 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPRC5A/RAI3 Antibody

  • G protein-coupled receptor, family C, group 5, member A
  • GPCR5A
  • GPRC5A
  • Orphan G-protein-coupling receptor PEIG-1
  • RAI3
  • RAI3G-protein coupled receptor family C group 5 member A
  • RAIG1
  • RAIG1RAIG-1
  • retinoic acid induced 3
  • retinoic acid responsive
  • Retinoic acid-induced gene 1 protein
  • retinoic acid-induced protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-58922
Species: Hu
Applications: WB
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-87160
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS4079
Species: Hu, Ca, Eq, Mk, Pm
Applications: IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-47314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-314
Species: Hu
Applications: WB, IP, PLA
AF6139
Species: Hu
Applications: ICC
NBP1-89743
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IHC-FrFl

Publications for GPRC5A/RAI3 Antibody (NBP1-89743)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GPRC5A/RAI3 Antibody (NBP1-89743) (0)

There are no reviews for GPRC5A/RAI3 Antibody (NBP1-89743). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPRC5A/RAI3 Antibody (NBP1-89743) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPRC5A/RAI3 Products

Bioinformatics Tool for GPRC5A/RAI3 Antibody (NBP1-89743)

Discover related pathways, diseases and genes to GPRC5A/RAI3 Antibody (NBP1-89743). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPRC5A/RAI3 Antibody (NBP1-89743)

Discover more about diseases related to GPRC5A/RAI3 Antibody (NBP1-89743).
 

Pathways for GPRC5A/RAI3 Antibody (NBP1-89743)

View related products by pathway.

PTMs for GPRC5A/RAI3 Antibody (NBP1-89743)

Learn more about PTMs related to GPRC5A/RAI3 Antibody (NBP1-89743).
 

Research Areas for GPRC5A/RAI3 Antibody (NBP1-89743)

Find related products by research area.

Blogs on GPRC5A/RAI3

There are no specific blogs for GPRC5A/RAI3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPRC5A/RAI3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPRC5A
Entrez