Immunocytochemistry/ Immunofluorescence: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human cell line U-2 OS shows localization to nucleoli, plasma membrane & vesicles. Antibody staining is shown in green.
Immunohistochemistry Free-Floating: GPRC5A/RAI3 Antibody [NBP1-89743] - Expression of RAI3 in human tissue and cell lines. Immunochemistry with RAI3-Antibody in different types of pancreatic tissue. Presentation in ...read more
Orthogonal Strategies: Analysis in human lung and skeletal muscle tissues using NBP1-89743 antibody. Corresponding GPRC5A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human lung shows moderate membranous positivity in pneumocytes.
Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human small intestine shows moderate positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human urinary bladder shows moderate membranous positivity in urothelial cells.
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - (J) RAI3 has a conspicuously low expression in BxPc3 and PaCaDD165 in comparison to the other cell lines in the group. (n = 3). (PLoS One. 2017; 12 (1): e0170390. ...read more
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Wester Blot: Pancreatic cell lines, where NC1 and NC2 represent negative controls.
Genetic Strategies: Western Blot analysis of different pathways were tested for alteration in knock-down with GPRC5A siRNA in comparison to negative control.Phosphorylation of STAT3 at Tyr705 is reduced in ...read more
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - GPRC5a expression levels in normal pancreas & PaCa (PAAD) tissue & cell lines. (A,B) The data-mining analysis showed that GPRC5a was significantly upregulated in PaCa ...read more
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Influence of GPRC5a knockout on the proliferation & migration ability in MIA PaCa-2 & TB32047 cells. (A–D) Western blot & sequencing results showing the GPRC5a knocked ...read more
Orthogonal Strategies: Analysis in human cell lines A-431 and U-251MG using Anti-GPRC5A antibody. Corresponding GPRC5A RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Novus Biologicals Rabbit GPRC5A/RAI3 Antibody - BSA Free (NBP1-89743) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-GPRC5A/RAI3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPRC5A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (81%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for GPRC5A/RAI3 Antibody - BSA Free
G protein-coupled receptor, family C, group 5, member A
GPCR5A
GPRC5A
Orphan G-protein-coupling receptor PEIG-1
RAI3
RAI3G-protein coupled receptor family C group 5 member A
RAIG1
RAIG1RAIG-1
retinoic acid induced 3
retinoic acid responsive
Retinoic acid-induced gene 1 protein
retinoic acid-induced protein 3
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our GPRC5A/RAI3 Antibody - BSA Free and receive a gift card or discount.