GPRC5A/RAI3 Antibody


Orthogonal Strategies: Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Analysis in human cell lines A-431 and U-251MG using anti-GPRC5A antibody. Corresponding GPRC5A RNA-seq data are presented for the same more
Immunocytochemistry/ Immunofluorescence: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human cell line U-2 OS shows localization to nucleoli, plasma membrane & vesicles.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining in human lung and skeletal muscle tissues using anti-GPRC5A antibody. Corresponding GPRC5A RNA-seq data are more
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Analysis in control (vector only transfected HEK293T lysate) and GPRC5A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - (J) RAI3 has a conspicuously low expression in BxPc3 and PaCaDD165 in comparison to the other cell lines in the group. (n = 3). (PLoS One. 2017; 12 (1): e0170390. more
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Wester Blot: Pancreatic cell lines, where NC1 and NC2 represent negative controls.
Immunohistochemistry Free-Floating: GPRC5A/RAI3 Antibody [NBP1-89743] - Expression of RAI3 in human tissue and cell lines. Immunochemistry with RAI3-Antibody in different types of pancreatic tissue. Presentation in more
Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IHC-FrFl
Validated by:

Orthogonal Strategies


Order Details

GPRC5A/RAI3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR
Specificity of human GPRC5A/RAI3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Immunohistochemistry Free-Floating 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPRC5A/RAI3 Protein (NBP1-89743PEP)
Read Publication using
NBP1-89743 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GPRC5A/RAI3 Antibody

  • G protein-coupled receptor, family C, group 5, member A
  • GPCR5A
  • GPRC5A
  • Orphan G-protein-coupling receptor PEIG-1
  • RAI3
  • RAI3G-protein coupled receptor family C group 5 member A
  • RAIG1
  • retinoic acid induced 3
  • retinoic acid responsive
  • Retinoic acid-induced gene 1 protein
  • retinoic acid-induced protein 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Species: Hu
Applications: WB, Simple Western, IP, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Eq, Mk, Pm
Applications: IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IHC-FrFl

Publications for GPRC5A/RAI3 Antibody (NBP1-89743)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for GPRC5A/RAI3 Antibody (NBP1-89743) (0)

There are no reviews for GPRC5A/RAI3 Antibody (NBP1-89743). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPRC5A/RAI3 Antibody (NBP1-89743) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPRC5A/RAI3 Products

Bioinformatics Tool for GPRC5A/RAI3 Antibody (NBP1-89743)

Discover related pathways, diseases and genes to GPRC5A/RAI3 Antibody (NBP1-89743). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPRC5A/RAI3 Antibody (NBP1-89743)

Discover more about diseases related to GPRC5A/RAI3 Antibody (NBP1-89743).

Pathways for GPRC5A/RAI3 Antibody (NBP1-89743)

View related products by pathway.

PTMs for GPRC5A/RAI3 Antibody (NBP1-89743)

Learn more about PTMs related to GPRC5A/RAI3 Antibody (NBP1-89743).

Research Areas for GPRC5A/RAI3 Antibody (NBP1-89743)

Find related products by research area.

Blogs on GPRC5A/RAI3

There are no specific blogs for GPRC5A/RAI3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPRC5A/RAI3 Antibody and receive a gift card or discount.


Gene Symbol GPRC5A