GPANK1/BAT4 Antibody

Images

 
Western Blot: GPANK1/BAT4 Antibody [NBP1-90165] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: GPANK1/BAT4 Antibody [NBP1-90165] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: GPANK1/BAT4 Antibody [NBP1-90165] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPANK1/BAT4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVCELSGRDAAQLAEEAGFPEVARMVRESHGETRSPENRSPTPSLQYCENCDTHFQDSNHRTSTAHLLSLSQGPQPPNLPLGVPISSPGFKLLLRGGWEPGMGLGPRGEGRANPIPTVLKRDQEGLGYRSAPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPANK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPANK1/BAT4 Protein (NBP1-90165PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPANK1/BAT4 Antibody

  • 6S54E
  • ANKRD59Protein G5
  • Ankyrin repeat domain-containing protein 59
  • BAT4G patch domain containing 10
  • D6S54EG patch domain and ankyrin repeats-containing protein 1
  • G patch domain and ankyrin repeats 1
  • G patch domain-containing protein 10
  • G5HLA-B-associated transcript 4
  • GPATCH10HLA-B associated transcript 4
  • protein BAT4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-23488
Species: Hu
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
NBP1-71706
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57274
Species: Hu
Applications: WB, ICC/IF
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB9120
Species: Hu
Applications: ICC
NBP1-43123
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, CyTOF-ready
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP1-90165
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GPANK1/BAT4 Antibody (NBP1-90165) (0)

There are no publications for GPANK1/BAT4 Antibody (NBP1-90165).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPANK1/BAT4 Antibody (NBP1-90165) (0)

There are no reviews for GPANK1/BAT4 Antibody (NBP1-90165). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPANK1/BAT4 Antibody (NBP1-90165) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPANK1/BAT4 Products

Bioinformatics Tool for GPANK1/BAT4 Antibody (NBP1-90165)

Discover related pathways, diseases and genes to GPANK1/BAT4 Antibody (NBP1-90165). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GPANK1/BAT4

There are no specific blogs for GPANK1/BAT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPANK1/BAT4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPANK1