GP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GP2 Antibody [NBP1-86061] - Staining GP2 in frozen human pancreatic sections using anti-GP2 antibody. GP2 stains primarily exocrine tissue in human pancreas. Image from verified customer review.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry analysis in human pancreas and skeletal muscle tissues using HPA016668 antibody. Corresponding GP2 RNA-seq data are presented for the same tissues.

Staining of human pancreas shows strong cytoplasmic and membranous positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLDEPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAHWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Validated from a verified customer review
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GP2 Protein (NBP1-86061PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GP2 Antibody - BSA Free

• DKFZp779K0533
• glycoprotein 2 (zymogen granule membrane)
• GP2
• pancreatic secretory granule membrane major glycoprotein GP2
• pancreatic zymogen granule membrane associated protein GP2
• Pancreatic zymogen granule membrane protein GP-2
• ZAP75

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GP2 Antibody (NBP1-86061)(2)

Publications using NBP1-86061

• Green KY, Kaufman SS, Nagata BM et al. Human norovirus targets enteroendocrine epithelial cells in the small intestine Nat Commun 2020-06-02 [PMID: 32488028] (IF/IHC, Human)
  
  Details:
  Citation using the Biotin format of this antibody.
• Muraoka S, Kume H, Watanabe S et al. Strategy for SRM-based verification of biomarker candidates discovered by iTRAQ method in limited breast cancer tissue samples. J Proteome Res 2012-08-03 [PMID: 22716024]

Review for GP2 Antibody (NBP1-86061) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer IF Human 02/15/2016

Summary

• Application: Immunofluorescence
• Species: Human

Bioinformatics

• Gene Symbol: GP2