GOT2 Antibody - BSA Free

Immunohistochemistry-Paraffin: GOT2 Antibody [NBP1-81565] - Analysis in human liver and bone marrow tissues. Corresponding GOT2 RNA-seq data are presented for the same tissues.

Western Blot: GOT2 Antibody [NBP1-81565] - Analysis in human cell lines PC-3 and SK-MEL-30. Corresponding GOT2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Immunohistochemistry-Paraffin: GOT2 Antibody [NBP1-81565] - Staining of human liver shows very strong cytoplasmic granular positivity in hepatocytes.

Western Blot: GOT2 Antibody [NBP1-81565] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: GOT2 Antibody [NBP1-81565] - Staining of human bone marrow shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: GOT2 Antibody [NBP1-81565] - Staining of human cerebellum shows strong cytoplasmic granular positivity in cells in granular layer.

Immunohistochemistry-Paraffin: GOT2 Antibody [NBP1-81565] - Staining of human testis shows strong cytoplasmic granular positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: GOT2 Antibody [NBP1-81565] - Staining of human small intestine shows moderate cytoplasmic granular positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GOT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GOT2 Antibody - BSA Free (NBP1-81565) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVER
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GOT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GOT2 Protein (NBP1-81565PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GOT2 Antibody - BSA Free

• aspartate aminotransferase, mitochondrial
• EC 2.6.1
• EC 2.6.1.1
• FABP-1
• FABPpm
• Fatty acid-binding protein
• FLJ40994
• Glutamate oxaloacetate transaminase 2
• glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase2)
• KAT4
• KATIV
• kynurenine aminotransferase IV
• mAspAT
• mitAAT
• Plasma membrane-associated fatty acid-binding protein
• Transaminase A

Background

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GOT2 Antibody (NBP1-81565)(1)

Publication using NBP1-81565

• Pareek V, Benkovic S Metabolic profiling reveals channeled de novo pyrimidine and purine biosynthesis fueled by mitochondrially generated aspartic acid in cancer cells Nature Communications 2025-10-08 [PMID: 41062501]

Bioinformatics

• Gene Symbol: GOT2