GO Protein alpha Antibody


Western Blot: GO Protein alpha Antibody [NBP2-38477] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Orthogonal Strategies: Immunohistochemistry-Paraffin: GO Protein alpha Antibody [NBP2-38477] - Staining in human cerebral cortex and pancreas tissues using anti-GNAO1 antibody. Corresponding GNAO1 RNA-seq data ...read more
Immunohistochemistry-Paraffin: GO Protein alpha Antibody [NBP2-38477] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: GO Protein alpha Antibody [NBP2-38477] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

GO Protein alpha Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: IQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECF
Specificity of human GO Protein alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GO Protein alpha Protein (NBP2-38477PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GO Protein alpha Antibody

  • DKFZp686O0962
  • G-ALPHA-o
  • GNAO
  • guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide O
  • guanine nucleotide binding protein, alpha activating polypeptide O
  • guanine nucleotide-binding protein G(o) subunit alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Species: Hu
Applications: Flow, IHC, CyTOF-ready
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ha, Mk, Rb
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, TCS

Publications for GO Protein alpha Antibody (NBP2-38477) (0)

There are no publications for GO Protein alpha Antibody (NBP2-38477).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GO Protein alpha Antibody (NBP2-38477) (0)

There are no reviews for GO Protein alpha Antibody (NBP2-38477). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GO Protein alpha Antibody (NBP2-38477) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for GO Protein alpha Antibody (NBP2-38477)

Discover related pathways, diseases and genes to GO Protein alpha Antibody (NBP2-38477). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GO Protein alpha Antibody (NBP2-38477)

Discover more about diseases related to GO Protein alpha Antibody (NBP2-38477).

Pathways for GO Protein alpha Antibody (NBP2-38477)

View related products by pathway.

PTMs for GO Protein alpha Antibody (NBP2-38477)

Learn more about PTMs related to GO Protein alpha Antibody (NBP2-38477).

Research Areas for GO Protein alpha Antibody (NBP2-38477)

Find related products by research area.

Blogs on GO Protein alpha

There are no specific blogs for GO Protein alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GO Protein alpha Antibody and receive a gift card or discount.


Gene Symbol GNAO1