GO Protein alpha Antibody

Images

 
Western Blot: GO Protein alpha Antibody [NBP2-38477] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Orthogonal Strategies: Immunohistochemistry-Paraffin: GO Protein alpha Antibody [NBP2-38477] - Staining in human cerebral cortex and pancreas tissues using anti-GNAO1 antibody. Corresponding GNAO1 RNA-seq data ...read more
Immunohistochemistry-Paraffin: GO Protein alpha Antibody [NBP2-38477] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: GO Protein alpha Antibody [NBP2-38477] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

GO Protein alpha Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECF
Specificity
Specificity of human GO Protein alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNAO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GO Protein alpha Protein (NBP2-38477PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GO Protein alpha Antibody

  • DKFZp686O0962
  • G-ALPHA-o
  • GNAO
  • guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide O
  • guanine nucleotide binding protein, alpha activating polypeptide O
  • guanine nucleotide-binding protein G(o) subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59008
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85299
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52477
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-89515
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4509
Species: Hu
Applications: WB, ICC
355-BM/CF
Species: Hu, Mu, Rt
MAB856
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP2-38868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22131
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NLS272
Species: Hu, Mu, Rt, Ha, Mk, Rb
Applications: IHC, IHC-P
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-36746
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, KO
NBP1-60120
Species: Hu
Applications: WB, TCS

Publications for GO Protein alpha Antibody (NBP2-38477) (0)

There are no publications for GO Protein alpha Antibody (NBP2-38477).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GO Protein alpha Antibody (NBP2-38477) (0)

There are no reviews for GO Protein alpha Antibody (NBP2-38477). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GO Protein alpha Antibody (NBP2-38477) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GO Protein alpha Antibody (NBP2-38477)

Discover related pathways, diseases and genes to GO Protein alpha Antibody (NBP2-38477). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GO Protein alpha Antibody (NBP2-38477)

Discover more about diseases related to GO Protein alpha Antibody (NBP2-38477).
 

Pathways for GO Protein alpha Antibody (NBP2-38477)

View related products by pathway.

PTMs for GO Protein alpha Antibody (NBP2-38477)

Learn more about PTMs related to GO Protein alpha Antibody (NBP2-38477).
 

Research Areas for GO Protein alpha Antibody (NBP2-38477)

Find related products by research area.

Blogs on GO Protein alpha

There are no specific blogs for GO Protein alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GO Protein alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNAO1
Uniprot