![Western Blot: GO Protein alpha Antibody [NBP2-38477] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue](http://images.novusbio.com/fullsize/GO-Protein-alpha-Antibody-Western-Blot-NBP2-38477-img0002.jpg "Western Blot: GO Protein alpha Antibody [NBP2-38477] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit GO Protein alpha Antibody - BSA Free (NBP2-38477) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECF |
| Predicted Species | Mouse (95%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GNAO1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GO Protein alpha Antibody (NBP2-38477)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: GO Protein alpha Antibody [NBP2-38477] - Staining in human cerebral cortex and pancreas tissues using anti-GNAO1 antibody. Corresponding GNAO1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GO-Protein-alpha-Antibody-Immunohistochemistry-Paraffin-NBP2-38477-img0005.jpg "Immunohistochemistry-Paraffin: GO Protein alpha Antibody [NBP2-38477] - Staining in human cerebral cortex and pancreas tissues using anti-GNAO1 antibody. Corresponding GNAO1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: GO Protein alpha Antibody [NBP2-38477] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/GO-Protein-alpha-Antibody-Immunohistochemistry-Paraffin-NBP2-38477-img0003.jpg "Immunohistochemistry-Paraffin: GO Protein alpha Antibody [NBP2-38477] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: GO Protein alpha Antibody [NBP2-38477] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/GO-Protein-alpha-Antibody-Immunohistochemistry-Paraffin-NBP2-38477-img0004.jpg "Immunohistochemistry-Paraffin: GO Protein alpha Antibody [NBP2-38477] - Staining of human pancreas shows low expression as expected.")
![Western Blot TBX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TBX3_AF4509_Western_Blot_5482.jpg)
![Immunocytochemistry TBX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TBX3_AF4509_Immunocytochemistry__Immunofluorescence_23053.jpg)
![Western Blot TBX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4509_human-tbx3-affinity-purified-polyclonal-ab-western-blot-1182021152353.jpg)
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![BMPR-IB/ALK-6 Antibody (88614) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "BMPR-IB/ALK-6 Antibody (88614) [Unconjugated]")
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")