Immunocytochemistry/ Immunofluorescence: GMF-beta Antibody [NBP1-89755] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol. Antibody staining is shown in green.
Staining of mouse cerebellum shows strong positivity in Purkinje cells.
Staining of mouse brain shows strong positivity in neurons and dendrites in cerebral cortex.
Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Analysis in human cell line A-431.
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: GMF-beta Antibody [NBP1-89755] - Tubulogenesis of human U87 glioblastoma cells is inhibited by GMF-beta knockdownA. Protein levels of GMF-beta in human glial cell line (HEB) & human glioma cell lines of ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GMFB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
17 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Mouse reactivity reported in scientific literature (PMID: 26101216).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for GMF-beta Antibody - BSA Free
glia maturation factor beta
glia maturation factor, beta
GMF
GMFB
GMFbeta
GMF-beta
Background
This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition ofproliferation of tumor cells
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for GMF-beta Antibody (NBP1-89755). (Showing 1 - 2 of 2 FAQs).
I am interested in purchasing this antibody (glial maturation factor-beta) but I have a trivial question before. As far as I know, gmf-beta has being described as an astrocytic factor, therefore I am quite puzzled observing the IHC that you reported. In fact, the signal appear concentrated in the soma (or nucleus) of some neurons. How do you justify that? Do you expect such a staining?
Based on what we know about this protein, we are seeing the expected staining pattern. Please see other instances of nuclear staining at the human protein atlas informational site (https://www.proteinatlas.org/ENSG00000197045-GMFB/subcellular). I think you may find it useful. Please let me know if you have any additional questions, technical@novusbio.com.
I am sure that based on your knowledge you are seeing the expected staining pattern. What concerns me is that the literature on gmf-beta is very poor and it all describes a maturation factor produced in astrocytes and retained in the cytosol. Could you please give me some reference to justify the fact that the signal is not in astrocytes but in neurons?
Here is the information that I received from the lab: We have tested this antibody (Anti-GMFB) in different tissues and have indeed seen some staining of glia cells as well. The image chosen to represent this product shows staining of neurons, and we believe this staining pattern to be accurate and representative based on the comment in UniProt regarding the function for this target: This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. (https://www.uniprot.org/uniprotkb/P60983/entry) Expression of this protein in neurons is also described in the following article; Wang et al. Polyclonal antibody localizes glia maturation factor fl-like immunoreactivity in neurons and glia, Brain Research, 591 (1992) 1-7 (PubMed ID 1446220).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our GMF-beta Antibody - BSA Free and receive a gift card or discount.