GMF-beta Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GMF-beta Antibody [NBP1-89755] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol. Antibody staining is shown in green.

Staining of mouse cerebellum shows strong positivity in Purkinje cells.

Staining of mouse brain shows strong positivity in neurons and dendrites in cerebral cortex.

Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Analysis in human cell line A-431.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

GMF-beta-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89755-img0020.jpg

GMF-beta-Antibody-Immunohistochemistry-NBP1-89755-img0019.jpg

Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - GMF-beta knockdown suppresses tumor growth & the formation of human-CD31 positive microvessels (hCD31-MVs) in orthotopic U87 xenograft modelsA. The cross-sectional appearance of xenografted gliomas from U87-mock group B. The cross-sectional appearance of xenografted gliomas from U87-shGMF-beta group. Gross tumor boundaries were delineated by white dotlines. C. A hCD31-microvessel & several hCD31-negative vessels in U87-mock tumor. D. No hCD31-MVs, only hCD31-negative vessels in U87-shGMF-beta tumor. Red solid arrows indicate hGMF-beta staining in tumor cells, black solid arrows show hCD31 staining on microvasular endothelia, & open arrows denote vessels negative for hCD31. Scale bar: 100 μm in upper pannels; 50 μm in lower pannels. E. Quantitative comparisons of gross tumor volume between U87-mock & U87-shGMF-beta group. F. Quantitative comparisons of hCD31-microvessel densities (MVDs) between U87-mock & U87-shGMF-beta group. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26515590), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

GMF-beta-Antibody-Western-Blot-NBP1-89755-img0022.jpg

GMF-beta-Antibody-Knockdown-Validated-NBP1-89755-img0021.jpg

Western Blot: GMF-beta Antibody [NBP1-89755] - Tubulogenesis of human U87 glioblastoma cells is inhibited by GMF-beta knockdownA. Protein levels of GMF-beta in human glial cell line (HEB) & human glioma cell lines of the different grades (CHG5, SHG44, U87). B. Assessment of GMF-beta knockdown in U87 cells by western blotting. C. Tube formation by U87 mock cells (left panel); impaired tube formation by U87-shGMF-beta cells (right panel). Inspection under a phase contrast fluorescent microscope (× 100). D. Quantified tubulogenesis of U87 mock cells & U87-shGMF-beta cells by pattern recognition system (left panel) & branch point counting system (right panel).*** indicates significant difference with P < 0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26515590), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GMF-beta Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GMF-beta Antibody - BSA Free (NBP1-89755) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-GMF-beta Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GMFB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  GMF-beta Protein (NBP1-89755PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26101216).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GMF-beta Antibody - BSA Free

• glia maturation factor beta
• glia maturation factor, beta
• GMF
• GMFB
• GMFbeta
• GMF-beta

Background

This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition ofproliferation of tumor cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GMF-beta Antibody (NBP1-89755)(3)

Publications using NBP1-89755

• Kuang XY, Jiang XF, Chen C et al. Expressions of glia maturation factor-B by tumor cells and endothelia correlate with neovascularization and poor prognosis in human glioma. Oncotarget. 2016-12-27 [PMID: 26515590] (IF/IHC, ICC/IF, WB, Human)
• Haynes EM, Asokan SB, King SJ et al. GMF-beta controls branched actin content and lamellipodial retraction in fibroblasts. J Cell Biol 2015-06-22 [PMID: 26101216] (ICC/IF, Mouse)
• Yu Y, Wu J, Fan Y et al. Evaluation of blastomere biopsy using a mouse model indicates the potential high risk of neurodegenerative disorders in the offspring. Mol Cell Proteomics. 2009-07-01 [PMID: 19279043]

FAQs for GMF-beta Antibody (NBP1-89755). (Showing 1 - 2 of 2 FAQs).

1. I am interested in purchasing this antibody (glial maturation factor-beta) but I have a trivial question before. As far as I know, gmf-beta has being described as an astrocytic factor, therefore I am quite puzzled observing the IHC that you reported. In fact, the signal appear concentrated in the soma (or nucleus) of some neurons. How do you justify that? Do you expect such a staining?
   • Based on what we know about this protein, we are seeing the expected staining pattern. Please see other instances of nuclear staining at the human protein atlas informational site (https://www.proteinatlas.org/ENSG00000197045-GMFB/subcellular). I think you may find it useful. Please let me know if you have any additional questions, technical@novusbio.com.
2. I am sure that based on your knowledge you are seeing the expected staining pattern. What concerns me is that the literature on gmf-beta is very poor and it all describes a maturation factor produced in astrocytes and retained in the cytosol. Could you please give me some reference to justify the fact that the signal is not in astrocytes but in neurons?
   • Here is the information that I received from the lab: We have tested this antibody (Anti-GMFB) in different tissues and have indeed seen some staining of glia cells as well. The image chosen to represent this product shows staining of neurons, and we believe this staining pattern to be accurate and representative based on the comment in UniProt regarding the function for this target: This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. (https://www.uniprot.org/uniprotkb/P60983/entry) Expression of this protein in neurons is also described in the following article; Wang et al. Polyclonal antibody localizes glia maturation factor fl-like immunoreactivity in neurons and glia, Brain Research, 591 (1992) 1-7 (PubMed ID 1446220).

Bioinformatics

• Gene Symbol: GMFB
• Entrez:
  • 2764(Human)
  • 63985(Mouse)
• Uniprot:
  • P60983()