GMF-beta Antibody

Images

 
Western Blot: GMF-beta Antibody [NBP1-89755] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: GMF-beta Antibody [NBP1-89755] - Staining of mouse cerebellum shows strong positivity in Purkinje cells.
Immunohistochemistry-Paraffin: GMF-beta Antibody [NBP1-89755] - Staining of human hippocampus shows strong cytoplasmic immunoreactivity in neurons.
Western Blot: GMF-beta Antibody [NBP1-89755] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).
Western Blot: GMF-beta Antibody [NBP1-89755] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4
Western Blot: GMF-beta Antibody [NBP1-89755] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: GMF-beta Antibody [NBP1-89755] - Staining of mouse somatosensory cortex shows immunoreactivity in neuronal cell bodies and dendrites.
Immunocytochemistry/ Immunofluorescence: GMF-beta Antibody [NBP1-89755] - Staining of mouse olfactory bulb shows immunoreactivity in neurons.
Immunocytochemistry/ Immunofluorescence: GMF-beta Antibody [NBP1-89755] - Staining of mouse lateral septum shows positivity in a subset of neurons.
Immunocytochemistry/ Immunofluorescence: GMF-beta Antibody [NBP1-89755] - Staining of mouse red nucleus shows immunoreactivity in neuronal cell bodies.
Immunohistochemistry-Paraffin: GMF-beta Antibody [NBP1-89755] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mouse, RatSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

GMF-beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GMFB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin HIER pH 6 retrieval is recommended.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
GMF-beta Protein (NBP1-89755PEP)
Publications
Read Publications using
NBP1-89755 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26101216).

Alternate Names for GMF-beta Antibody

  • glia maturation factor beta
  • glia maturation factor, beta
  • GMF
  • GMFB
  • GMFbeta
  • GMF-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF2439
Species: Mu
Applications: WB, IHC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
NBP2-31367
Species: Hu
Applications: WB, ICC/IF
NBP1-05161
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB18251
Species: Hu, Mu
Applications: WB, Simple Western

Publications for GMF-beta Antibody (NBP1-89755)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for GMF-beta Antibody (NBP1-89755) (0)

There are no reviews for GMF-beta Antibody (NBP1-89755). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GMF-beta Antibody (NBP1-89755). (Showing 1 - 2 of 2 FAQs).

  1. I am interested in purchasing this antibody (glial maturation factor-beta) but I have a trivial question before. As far as I know, gmf-beta has being described as an astrocytic factor, therefore I am quite puzzled observing the IHC that you reported. In fact, the signal appear concentrated in the soma (or nucleus) of some neurons. How do you justify that? Do you expect such a staining?
    • Based on what we know about this protein, we are seeing the expected staining pattern. Please see other instances of nuclear staining at the human protein atlas informational site. I think you may find it useful. Please let me know if you have any additional questions, technical@novusbio.com.
  2. I am sure that based on your knowledge you are seeing the expected staining pattern. What concerns me is that the literature on gmf-beta is very poor and it all describes a maturation factor produced in astrocytes and retained in the cytosol. Could you please give me some reference to justify the fact that the signal is not in astrocytes but in neurons?
    • Here is the information that I received from the lab: We have tested this antibody (Anti-GMFB) in different tissues and have indeed seen some staining of glia cells as well. The image chosen to represent this product shows staining of neurons, and we believe this staining pattern to be accurate and representative based on the comment in UniProt regarding the function for this target: This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. (UniProt P60983) Expression of this protein in neurons is also described in the following article; Wang et al. Polyclonal antibody localizes glia maturation factor fl-like immunoreactivity in neurons and glia, Brain Research, 591 (1992) 1-7 (PubMed ID 1446220).

Secondary Antibodies

 

Isotype Controls

Additional GMF-beta Antibody Products

Related Products by Gene

Bioinformatics Tool for GMF-beta Antibody (NBP1-89755)

Discover related pathways, diseases and genes to GMF-beta Antibody (NBP1-89755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GMF-beta Antibody (NBP1-89755)

Discover more about diseases related to GMF-beta Antibody (NBP1-89755).
 

Pathways for GMF-beta Antibody (NBP1-89755)

View related products by pathway.

PTMs for GMF-beta Antibody (NBP1-89755)

Learn more about PTMs related to GMF-beta Antibody (NBP1-89755).

Blogs on GMF-beta

There are no specific blogs for GMF-beta, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol GMFB
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-89755 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought