GMF-beta Antibody

Images

 
Western Blot: GMF-beta Antibody [NBP1-89755] - Tubulogenesis of human U87 glioblastoma cells is inhibited by GMF-beta knockdown. Protein levels of GMF-beta in human glial cell line (HEB) and human glioma cell lines of ...read more
Immunocytochemistry/ Immunofluorescence: GMF-beta Antibody [NBP1-89755] - GMF-beta is involved in neovasculogenesis in human glioblastoma. A. Co-expression of GMF-beta and CD31 in several tumor cells. B. The ...read more
Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - GMF-beta expression is positively associated with tumor grade and microvessel density (MVD) in human glioma. Distributions of GMF-beta in normal brain tissue (left ...read more
Western Blot: GMF-beta Antibody [NBP1-89755] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Western Blot: GMF-beta Antibody [NBP1-89755] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue
Western Blot: GMF-beta Antibody [NBP1-89755] - Analysis in human cell line A-431.
Western Blot: GMF-beta Antibody [NBP1-89755] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: GMF-beta Antibody [NBP1-89755] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GMF-beta Antibody [NBP1-89755] - Staining of human hippocampus shows strong cytoplasmic immunoreactivity in neurons.
Immunohistochemistry-Paraffin: GMF-beta Antibody [NBP1-89755] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: GMF-beta Antibody [NBP1-89755] - Staining of human cerebral cortex shows neuronal positivity.
Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - Staining of mouse somatosensory cortex shows immunoreactivity in neuronal cell bodies and dendrites.
Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - Staining of mouse olfactory bulb shows immunoreactivity in neurons.
Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - Staining of mouse lateral septum shows positivity in a subset of neurons.
Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - Staining of mouse red nucleus shows immunoreactivity in neuronal cell bodies.
Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - Staining of mouse cerebellum shows strong positivity in Purkinje cells.
Genetic Strategies: Knockdown Validated: GMF-beta Antibody [NBP1-89755] - Tubulogenesis of human U87 glioblastoma cells is inhibited by GMF-beta knockdown. Assessment of GMF-beta knockdown in U87 cells by western ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

GMF-beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GMFB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
GMF-beta Protein (NBP1-89755PEP)
Publications
Read Publications using
NBP1-89755 in the following applications:

  • 2 publications
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26101216).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GMF-beta Antibody

  • glia maturation factor beta
  • glia maturation factor, beta
  • GMF
  • GMFB
  • GMFbeta
  • GMF-beta

Background

This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition ofproliferation of tumor cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91803
Species: Hu
Applications: IHC, IHC-P, WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
H00004340-B01P
Species: Hu, Rt
Applications: WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
256-GF/CF
Species: Hu
Applications: BA
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-31367
Species: Hu
Applications: ICC/IF, WB
NBP1-33177
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
7954-GM/CF
Species: Hu
Applications: BA
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
210-TA
Species: Hu
Applications: BA
DIP100
Species: Hu
Applications: ELISA
232-FA/CF
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
DCP00
Species: Hu
Applications: ELISA
NBP1-89755
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for GMF-beta Antibody (NBP1-89755)(3)

Reviews for GMF-beta Antibody (NBP1-89755) (0)

There are no reviews for GMF-beta Antibody (NBP1-89755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GMF-beta Antibody (NBP1-89755). (Showing 1 - 2 of 2 FAQs).

  1. I am interested in purchasing this antibody (glial maturation factor-beta) but I have a trivial question before. As far as I know, gmf-beta has being described as an astrocytic factor, therefore I am quite puzzled observing the IHC that you reported. In fact, the signal appear concentrated in the soma (or nucleus) of some neurons. How do you justify that? Do you expect such a staining?
    • Based on what we know about this protein, we are seeing the expected staining pattern. Please see other instances of nuclear staining at the human protein atlas informational site. I think you may find it useful. Please let me know if you have any additional questions, technical@novusbio.com.
  2. I am sure that based on your knowledge you are seeing the expected staining pattern. What concerns me is that the literature on gmf-beta is very poor and it all describes a maturation factor produced in astrocytes and retained in the cytosol. Could you please give me some reference to justify the fact that the signal is not in astrocytes but in neurons?
    • Here is the information that I received from the lab: We have tested this antibody (Anti-GMFB) in different tissues and have indeed seen some staining of glia cells as well. The image chosen to represent this product shows staining of neurons, and we believe this staining pattern to be accurate and representative based on the comment in UniProt regarding the function for this target: This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. (UniProt P60983) Expression of this protein in neurons is also described in the following article; Wang et al. Polyclonal antibody localizes glia maturation factor fl-like immunoreactivity in neurons and glia, Brain Research, 591 (1992) 1-7 (PubMed ID 1446220).

Secondary Antibodies

 

Isotype Controls

Additional GMF-beta Products

Bioinformatics Tool for GMF-beta Antibody (NBP1-89755)

Discover related pathways, diseases and genes to GMF-beta Antibody (NBP1-89755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GMF-beta Antibody (NBP1-89755)

Discover more about diseases related to GMF-beta Antibody (NBP1-89755).
 

Pathways for GMF-beta Antibody (NBP1-89755)

View related products by pathway.

PTMs for GMF-beta Antibody (NBP1-89755)

Learn more about PTMs related to GMF-beta Antibody (NBP1-89755).
 

Research Areas for GMF-beta Antibody (NBP1-89755)

Find related products by research area.

Blogs on GMF-beta

There are no specific blogs for GMF-beta, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GMF-beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GMFB
Entrez
Uniprot