Recombinant Human GMCL1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GMCL1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-515 of Human GMCL1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGSLSSRVLRQPRPALAQQAQGARAGGSARRPDTGDDAAGHGFCYCAGSHKRKRSSGSFCYCHPDSETDEDEEEGDEQQRLLNTPRRKKLKSTSKYIYQTLFLNGENSDIKICALGEEWSLHKIYLCQSGYFSSMFSGSWKESSMNIIELEIPDQNIDVEALQVAFGSLYRDDVLIKPSRVVAILAAACLLQLDGLIQQCGETMKETVNVKTVCGYYTSAGTYGLDSVKKKCLEWLLNNLMTHQNVELFKELSINVMKQLIGSSNLFVMQVEMDIYTALKKWMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEGMAFLETEQGKPFVSVFRHLRLQYIISDLASARIIEQDAVVPSEWLSSVYKQQWFAMLRAEQDSEVGPQEINKEELEGNSMRCGRKLAKDGEYCWRWTGFNFGFDLLVTYTNRYIIFKRNTLNQPCSGSVSLQPRRSIAFRLRLASFDSSGKLICSRTTGYQILTLEKDQEQVVMNLDSRLLIFPLYICCNFLYISPEKKN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GMCL1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00064395-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GMCL1 Protein

  • BTBD13
  • FLJ13057
  • GCL
  • GCL1
  • germ cell-less homolog 1 (Drosophila)
  • germ cell-less protein-like 1

Background

This gene encodes a nuclear envelope protein that appears to be involved in spermatogenesis, either directly or by influencing genes that play a more direct role in the process. This multi-exon locus is the homolog of the mouse and drosophila germ cell-less gene but the human genome also contains a single-exon locus on chromosome 5 that contains an open reading frame capable of encoding a highly-related protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-33405
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB300-131
Species: Hu, Mu, Rt, Po, Av, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00064395-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for GMCL1 Recombinant Protein (H00064395-P01)(1)

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
All Species

Reviews for GMCL1 Recombinant Protein (H00064395-P01) (0)

There are no reviews for GMCL1 Recombinant Protein (H00064395-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GMCL1 Recombinant Protein (H00064395-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GMCL1 Products

Bioinformatics Tool for GMCL1 Recombinant Protein (H00064395-P01)

Discover related pathways, diseases and genes to GMCL1 Recombinant Protein (H00064395-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GMCL1 Recombinant Protein (H00064395-P01)

Discover more about diseases related to GMCL1 Recombinant Protein (H00064395-P01).
 

Pathways for GMCL1 Recombinant Protein (H00064395-P01)

View related products by pathway.

Blogs on GMCL1

There are no specific blogs for GMCL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GMCL1 Antibody
NBP1-88505

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GMCL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GMCL1