GM130/GOLGA2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GM130/GOLGA2 Antibody [NBP1-89757] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.

Staining of human gastrointestinal, placenta, prostate and squamous epithelia using Anti-GOLGA2 antibody NBP1-89757 (A) shows similar protein distribution across tissues to independent antibody NBP1-89756 (B).

Staining of human cervix, uterine shows strong granular cytoplasmic positivity in squamous epithelial cells.

Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.

Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

Western Blot: GM130/GOLGA2 Antibody [NBP1-89757] - Analysis using Anti-GOLGA2 antibody NBP1-89757 (A) shows similar pattern to independent antibody NBP1-89756 (B).

Analysis in human cell line U-138 MG.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GM130/GOLGA2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GM130/GOLGA2 Antibody - BSA Free (NBP1-89757) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-GM130/GOLGA2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLK
• Marker: Golgi Apparatus Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GOLGA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GM130/GOLGA2 Protein (NBP1-89757PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24302887)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GM130/GOLGA2 Antibody - BSA Free

• 130 kDa cis-Golgi matrix protein
• GM130 autoantigen
• GM130
• GM130Golgi matrix protein GM130
• GOLGA2
• golgi autoantigen, golgin subfamily a, 2
• golgin A2
• Golgin subfamily A member 2
• Golgin-95
• MGC20672
• SY11 Protein

Background

Golgi Matrix Protein (GM130) is peripheral cytoplamic protein that is bound to the Golgi membranes. It has been implicated as a maintainer of cis-Golgi structure (1). During mitosis, it regulates the disassembly and reassembly of the Golgi complex. It is also linked to docking and fusion of coatomer (COP I) coated vesicles to the Golgi membrane (2). The COOH-terminal domain of GM130 is highly homologous to Golgi human auto-antigen, golgin-95. GM130 interacts specifically and GTP-dependent manner with Rab1b protein, a regulator of anterograde traffic between ER and Golgi membranes (3). GM130 is also activator of YSK1, an essential player in cell migration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GM130/GOLGA2 Antibody (NBP1-89757)(2)

Publications using NBP1-89757

• Zajac O, Leclere R, Nicolas A et al. AXL Controls Directed Migration of Mesenchymal Triple-Negative Breast Cancer Cells Cells 2020-01-19 [PMID: 31963783] (Immunocytochemistry/ Immunofluorescence)
• Cui C, Chatterjee B, Lozito TP et al. Wdpcp, a PCP Protein Required for Ciliogenesis, Regulates Directional Cell Migration and Cell Polarity by Direct Modulation of the Actin Cytoskeleton. PLoS Biol 2013-11-01 [PMID: 24302887] (ICC/IF)

Bioinformatics

• Gene Symbol: GOLGA2