GM130/GOLGA2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GM130/GOLGA2 Antibody [NBP1-89756] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GM130/GOLGA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE
Marker
Golgi Apparatus Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GOLGA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GM130/GOLGA2 Protein (NBP1-89756PEP)
Publications
Read Publication using NBP1-89756.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GM130/GOLGA2 Antibody

  • 130 kDa cis-Golgi matrix protein
  • GM130 autoantigen
  • GM130
  • GM130Golgi matrix protein GM130
  • GOLGA2
  • golgi autoantigen, golgin subfamily a, 2
  • golgin A2
  • Golgin subfamily A member 2
  • Golgin-95
  • MGC20672
  • SY11 Protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38528
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-89747
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83352
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-39027
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89756
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GM130/GOLGA2 Antibody (NBP1-89756)(1)

Reviews for GM130/GOLGA2 Antibody (NBP1-89756) (0)

There are no reviews for GM130/GOLGA2 Antibody (NBP1-89756). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GM130/GOLGA2 Antibody (NBP1-89756) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GM130/GOLGA2 Products

Bioinformatics Tool for GM130/GOLGA2 Antibody (NBP1-89756)

Discover related pathways, diseases and genes to GM130/GOLGA2 Antibody (NBP1-89756). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GM130/GOLGA2 Antibody (NBP1-89756)

Discover more about diseases related to GM130/GOLGA2 Antibody (NBP1-89756).
 

Pathways for GM130/GOLGA2 Antibody (NBP1-89756)

View related products by pathway.

PTMs for GM130/GOLGA2 Antibody (NBP1-89756)

Learn more about PTMs related to GM130/GOLGA2 Antibody (NBP1-89756).
 

Research Areas for GM130/GOLGA2 Antibody (NBP1-89756)

Find related products by research area.

Blogs on GM130/GOLGA2

There are no specific blogs for GM130/GOLGA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GM130/GOLGA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLGA2
Entrez