GM130/GOLGA2 Antibody


Western Blot: GM130/GOLGA2 Antibody [NBP1-89756] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-GOLGA2 antibody. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89756] - Staining in human parathyroid gland and lymph node tissues using anti-GOLGA2 antibody. Corresponding GOLGA2 RNA-seq data are presented for the same more
Western Blot: GM130/GOLGA2 Antibody [NBP1-89756] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: GM130/GOLGA2 Antibody [NBP1-89756] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human parathyroid gland shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD

Order Details

GM130/GOLGA2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE
Golgi Apparatus Marker
Specificity of human GM130/GOLGA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
GM130/GOLGA2 Lysate (NBP2-65274)
Control Peptide
GM130/GOLGA2 Protein (NBP1-89756PEP)
Read Publication using NBP1-89756.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GM130/GOLGA2 Antibody

  • 130 kDa cis-Golgi matrix protein
  • GM130 autoantigen
  • GM130
  • GM130Golgi matrix protein GM130
  • GOLGA2
  • golgi autoantigen, golgin subfamily a, 2
  • golgin A2
  • Golgin subfamily A member 2
  • Golgin-95
  • MGC20672
  • SY11 Protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KO
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for GM130/GOLGA2 Antibody (NBP1-89756)(1)

Reviews for GM130/GOLGA2 Antibody (NBP1-89756) (0)

There are no reviews for GM130/GOLGA2 Antibody (NBP1-89756). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GM130/GOLGA2 Antibody (NBP1-89756) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional GM130/GOLGA2 Products

Bioinformatics Tool for GM130/GOLGA2 Antibody (NBP1-89756)

Discover related pathways, diseases and genes to GM130/GOLGA2 Antibody (NBP1-89756). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GM130/GOLGA2 Antibody (NBP1-89756)

Discover more about diseases related to GM130/GOLGA2 Antibody (NBP1-89756).

Pathways for GM130/GOLGA2 Antibody (NBP1-89756)

View related products by pathway.

PTMs for GM130/GOLGA2 Antibody (NBP1-89756)

Learn more about PTMs related to GM130/GOLGA2 Antibody (NBP1-89756).

Research Areas for GM130/GOLGA2 Antibody (NBP1-89756)

Find related products by research area.

Blogs on GM130/GOLGA2

There are no specific blogs for GM130/GOLGA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GM130/GOLGA2 Antibody and receive a gift card or discount.


Gene Symbol GOLGA2