Glyoxalase II/HAGH Antibody - BSA Free

Western Blot: Glyoxalase II/HAGH Antibody [NBP2-38909] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue

Immunohistochemistry-Paraffin: Glyoxalase II/HAGH Antibody [NBP2-38909] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glyoxalase II/HAGH Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKL
• Predicted Species: Mouse (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HAGH
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Glyoxalase II/HAGH Recombinant Protein Antigen (NBP2-38909PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Glyoxalase II/HAGH Antibody - BSA Free

• EC 3.1.2.6
• GLO2hydroxyacyl glutathione hydrolase
• Glx II
• GLX2
• GLXII
• Glyoxalase II
• HAGH
• HAGH1GLX2
• hydroxyacylglutathione hydrolase
• hydroxyacylglutathione hydrolase, mitochondrial
• hydroxyacylglutathione hydroxylase

Background

HAGH, also known as Hydroxyacylglutathione hydrolase mitochondrial, has a 308 amino acid long isoform that is 34 kDa and located in the mitochondrion matrix and a short 260 amino acid isoform that is 29 kDa and located in the cytoplasm; is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. Studies are being performed on the relationship of this protein to glyoxalase ii deficiency, breast carcinoma, carcinoma, familial Mediterranean fever, muscular dystrophy, thrombocytosis, neisseria meningitides, hyperglycemia, bladder carcinoma, alzheimer's disease, prostate cancer, hepatitis b, and prostatitis. HAGH protein involvement has been observed with relation to pyruvate metabolism, secondary metabolite metabolism, methylglyoxal degradation, and (R)-lactate from methylglyoxal pathways where it interacts with MYOC, PRDX2, VPS72, SOD1, and DR1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HAGH
• Uniprot:
  • Q16775(Human)