Glyoxalase II/HAGH Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: NEKLVKLESGLKVYGGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAGC |
| Predicted Species |
Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HAGH |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Glyoxalase II/HAGH Antibody - BSA Free
Background
HAGH, also known as Hydroxyacylglutathione hydrolase mitochondrial, has a 308 amino acid long isoform that is 34 kDa and located in the mitochondrion matrix and a short 260 amino acid isoform that is 29 kDa and located in the cytoplasm; is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. Studies are being performed on the relationship of this protein to glyoxalase ii deficiency, breast carcinoma, carcinoma, familial Mediterranean fever, muscular dystrophy, thrombocytosis, neisseria meningitides, hyperglycemia, bladder carcinoma, alzheimer's disease, prostate cancer, hepatitis b, and prostatitis. HAGH protein involvement has been observed with relation to pyruvate metabolism, secondary metabolite metabolism, methylglyoxal degradation, and (R)-lactate from methylglyoxal pathways where it interacts with MYOC, PRDX2, VPS72, SOD1, and DR1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for Glyoxalase II/HAGH Antibody (NBP2-38502) (0)
There are no publications for Glyoxalase II/HAGH Antibody (NBP2-38502).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glyoxalase II/HAGH Antibody (NBP2-38502) (0)
There are no reviews for Glyoxalase II/HAGH Antibody (NBP2-38502).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Glyoxalase II/HAGH Antibody (NBP2-38502) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glyoxalase II/HAGH Products
Research Areas for Glyoxalase II/HAGH Antibody (NBP2-38502)
Find related products by research area.
|
Blogs on Glyoxalase II/HAGH