Glyoxalase II/HAGH Antibody

Images

 
Western Blot: Glyoxalase II/HAGH Antibody [NBP1-56760] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Glyoxalase II/HAGH Antibody [NBP1-56760] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Glyoxalase II/HAGH Antibody [NBP1-56760] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GPSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glyoxalase II/HAGH Antibody Summary

Immunogen
Synthetic peptides corresponding to HAGH(hydroxyacylglutathione hydrolase) The peptide sequence was selected from the C terminal of HAGH. Peptide sequence STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAGH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HAGH and was validated on Western blot.
Control
Glyoxalase II/HAGH Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Glyoxalase II/HAGH Antibody

  • EC 3.1.2.6
  • GLO2hydroxyacyl glutathione hydrolase
  • Glx II
  • GLX2
  • GLXII
  • Glyoxalase II
  • HAGH
  • HAGH1GLX2
  • hydroxyacylglutathione hydrolase
  • hydroxyacylglutathione hydrolase, mitochondrial
  • hydroxyacylglutathione hydroxylase

Background

HAGH belongs to the metallo-beta-lactamase superfamily, glyoxalase II family. It is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-76932
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-52926
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Gt, GP, Rb, Sh, Ye, Ze
Applications: WB
NBP2-66995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89727
Species: Hu
Applications: IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-59242
Species: Hu, Rt, Po, Bv, Eq, Ze
Applications: WB
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-56760
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB

Publications for Glyoxalase II/HAGH Antibody (NBP1-56760) (0)

There are no publications for Glyoxalase II/HAGH Antibody (NBP1-56760).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glyoxalase II/HAGH Antibody (NBP1-56760) (0)

There are no reviews for Glyoxalase II/HAGH Antibody (NBP1-56760). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glyoxalase II/HAGH Antibody (NBP1-56760) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Glyoxalase II/HAGH Products

Bioinformatics Tool for Glyoxalase II/HAGH Antibody (NBP1-56760)

Discover related pathways, diseases and genes to Glyoxalase II/HAGH Antibody (NBP1-56760). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glyoxalase II/HAGH Antibody (NBP1-56760)

Discover more about diseases related to Glyoxalase II/HAGH Antibody (NBP1-56760).
 

Pathways for Glyoxalase II/HAGH Antibody (NBP1-56760)

View related products by pathway.

Research Areas for Glyoxalase II/HAGH Antibody (NBP1-56760)

Find related products by research area.

Blogs on Glyoxalase II/HAGH

There are no specific blogs for Glyoxalase II/HAGH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glyoxalase II/HAGH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAGH
Uniprot