Western Blot: Glycine Receptor alpha 2 Antibody [NBP3-03685] - Analysis of various lysates, using GLRA2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 ...read more
Novus Biologicals Rabbit Glycine Receptor alpha 2 Antibody - Azide and BSA Free (NBP3-03685) is a polyclonal antibody validated for use in IHC, WB and ELISA. Anti-Glycine Receptor alpha 2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 350-420 of human Glycine Receptor alpha 2 (NP_002054.1). RLRRRQKRQNKEEDVTRESRFNFSGYGMGHCLQVKDGTAVKATPANPLPQPPKDGDAIKKKFVDRAKRIDT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLRA2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Western Blot 1:500 - 1:1000
Theoretical MW
52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP3-03685 in the following applications:
Alternate Names for Glycine Receptor alpha 2 Antibody - Azide and BSA Free
GLR
glycine receptor alpha 2 subunit
glycine receptor subunit alpha-2
Glycine Receptor, Alpha polypeptide
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Glycine Receptor alpha 2 Antibody (NBP3-03685)(1)
We have publications tested in 1 confirmed species: Mouse.
We have publications tested in 1 application: IHC.
Reviews for Glycine Receptor alpha 2 Antibody (NBP3-03685) (0)
There are no reviews for Glycine Receptor alpha 2 Antibody (NBP3-03685).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Glycine Receptor alpha 2 Antibody - Azide and BSA Free and receive a gift card or discount.