Glycerol Kinase Antibody

Images

 
Immunohistochemistry-Paraffin: Glycerol Kinase Antibody [NBP2-32561] - GK2 Antibody [NBP2-32561] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glycerol Kinase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IERLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Glycerol Kinase Recombinant Protein Antigen (NBP2-32561PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glycerol Kinase Antibody

  • ATP:glycerol 3-phosphotransferase
  • EC 2.7.1.30
  • GK
  • GK1
  • GKD
  • glpK
  • Glycerokinase
  • Glycerol Kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80533
Species: Mu
Applications: WB
PP-H7431-00
Species: Hu
Applications: WB
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31241
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-90367
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-32561
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Glycerol Kinase Antibody (NBP2-32561) (0)

There are no publications for Glycerol Kinase Antibody (NBP2-32561).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycerol Kinase Antibody (NBP2-32561) (0)

There are no reviews for Glycerol Kinase Antibody (NBP2-32561). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Glycerol Kinase Antibody (NBP2-32561) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glycerol Kinase Products

Bioinformatics Tool for Glycerol Kinase Antibody (NBP2-32561)

Discover related pathways, diseases and genes to Glycerol Kinase Antibody (NBP2-32561). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycerol Kinase Antibody (NBP2-32561)

Discover more about diseases related to Glycerol Kinase Antibody (NBP2-32561).
 

Pathways for Glycerol Kinase Antibody (NBP2-32561)

View related products by pathway.

PTMs for Glycerol Kinase Antibody (NBP2-32561)

Learn more about PTMs related to Glycerol Kinase Antibody (NBP2-32561).

Blogs on Glycerol Kinase

There are no specific blogs for Glycerol Kinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glycerol Kinase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GK
Entrez