Home » Glycerol Kinase » Glycerol Kinase Antibodies » Glycerol Kinase Antibody

Glycerol Kinase Antibody

 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Glycerol kinase Antibody [NBP1-57033] - U937 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Glycerol kinase Antibody [NBP1-57033] - U937 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Glycerol Kinase Antibody Summary

Immunogen
Synthetic peptides corresponding to GK (glycerol kinase). The peptide sequence was selected from the middle region of GK. Peptide sequence MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GK and was validated on Western blot.
Control Peptide
Glycerol Kinase Protein (NBP1-57033PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-57033 in the following application:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Glycerol Kinase Antibody

  • ATP:glycerol 3-phosphotransferase
  • EC 2.7.1.30
  • GK
  • GK1
  • GKD
  • glpK
  • Glycerokinase
  • Glycerol Kinase

Background

The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Glucokinase/GCK
Antibody
NBP1-33144
Western Blot: Glucokinase/GCK Antibody [NBP1-33144] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Glucokinase antibody [N1C1-2] diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Glucokinase/GCK Antibody [NBP1-33144] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Glucokinase protein stained by Glucokinase antibody [N1C1-2] diluted at 1:500.Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Glucokinase/GCK Antibody [NBP1-33144] - MCF7 xenograft, using Glucokinase antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
G6PC Antibody
NBP1-80533
Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml
Western Blot: G6PC Antibody [NBP1-80533] - Mouse Intestine, concentration 1 ug/ml.
Western Blot: G6PC Antibody [NBP1-80533] - Sample Tissue: Mouse Lung Antibody Dilution: 1.0ug/ml
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB
DAX1/NR0B1
Antibody (H7431)
PP-H7431-00
DAX1/NR0B1 Antibody (H7431)
(2 Publications)
Species: Hu
Applications: WB
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining in human skeletal muscle and tonsil tissues. Corresponding DMD RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
(8 Reviews)
(29 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
GCKR Antibody
(OTI1E7)
NBP2-03396
Western Blot: GCKR Antibody (1E7) [NBP2-03396] - Analysis of extracts (35 ug) from 9 different cell lines by using anti-GCKR monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).(1:200)
Immunocytochemistry/Immunofluorescence: GCKR Antibody (1E7) [NBP2-03396] Staining of COS7 cells transiently transfected by pCMV6-ENTRY GCKR.
Immunohistochemistry-Paraffin: GCKR Antibody (1E7) [NBP2-03396] - Staining of paraffin-embedded Human Kidney tissue using anti-GCKR mouse monoclonal antibody.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Glut2 Antibody
NBP2-22218
Western Blot: Glut2 Antibody [NBP2-22218] - Analysis of Glut2 in total lysates of MIN6 cells using anti-Glut2 (NBP2-22218) antibody at 1/500 dilution. Image was submitted via customer review.
Immunocytochemistry/Immunofluorescence: Glut2 Antibody [NBP2-22218] - Glut2 antibody was tested in HepG2 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: Glut2 Antibody [NBP2-22218] - Histology and immunostaining of pancreas in treated and untreated mice with STZ. (i, iv) H-E of a pancreatic islet in untreated and STZ-WT mice; (ii, v) and (iii,vi) reduction of Glut2 and insulin expression in STZ-WT mice compared to control mice. B. ( Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0105550), licensed under a CC-BY licence.
(2 Reviews)
(7 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PCK2 Antibody
(JB52-39)
NBP2-75610
Western Blot: PCK2 Antibody (JB52-39) [NBP2-75610] - Analysis of PCK2 on human kidney tissue (1) and MCF-7 cell (2) lysate using anti-PCK2 antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: PCK2 Antibody (JB52-39) [NBP2-75610] - Staining PCK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PCK2 Antibody (JB52-39) [NBP2-75610] - Analysis of paraffin-embedded rat kidney tissue using anti-PCK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
GLP1 Antibody
(5B10) - BSA Free
NBP1-05189
Immunocytochemistry/Immunofluorescence: Glucagon Antibody (5B10) - BSA Free [NBP1-05189] - Staining in human liver tissue. Signal is strong in the cytoplasmic site of hepatocytes. Dilution: 1:4000.
Immunohistochemistry-Paraffin: Glucagon Antibody (5B10) - BSA Free [NBP1-05189] - Staining of Human liver tissue. Hepatocytes were stained strongly. Dilution: 1:3200
Immunocytochemistry/Immunofluorescence: Glucagon Antibody (5B10) - BSA Free [NBP1-05189] - Staining in human pancreas tissue. Signal is strong in alpha cells. Dilution: 1:4000.
Species: Hu, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(22 Reviews)
(302 Publications)
Species: Hu
CD77 Synthase
Antibody
NBP1-90824
Western Blot: CD77 Synthase Antibody [NBP1-90824] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402588)
Immunocytochemistry/Immunofluorescence: CD77 Synthase Antibody [NBP1-90824] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.
Species: Hu
Applications: WB, ICC/IF
ZAK Antibody (3G5)
H00051776-M03
Western Blot: ZAK Antibody (3G5) [H00051776-M03] - ZAK monoclonal antibody (M03), clone 3G5. Western Blot analysis of ZAK expression in human stomach.
Immunocytochemistry/Immunofluorescence: ZAK Antibody (3G5) [H00051776-M03] - Analysis of monoclonal antibody to ZAK on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: ZAK Antibody (3G5) [H00051776-M03] - Analysis of monoclonal antibody to ZAK on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Guanylate kinase
Antibody (OTI4A8)
NBP2-00594
Western Blot: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Guanylate kinase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Guanylate kinase.
Immunohistochemistry-Paraffin: Guanylate kinase Antibody (4A8) [NBP2-00594] Staining of paraffin-embedded Human prostate tissue using anti-Guanylate kinase mouse monoclonal antibody.
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Guanylate kinase antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
ST3GAL4 Antibody
NBP1-62481
Western Blot: ST3GAL4 Antibody [NBP1-62481] - Sample Type: MCF7 Antibody Dilution: 1.0 ug/ml ST3GAL4 is supported by BioGPS gene expression data to be expressed in MCF7
Western Blot: ST3GAL4 Antibody [NBP1-62481] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Western Blot: ST3GAL4 Antibody [NBP1-62481] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml ST3GAL4 is supported by BioGPS gene expression data to be expressed in HeLa
Species: Hu
Applications: WB
Fatty Acid
Synthase/FASN Antibod
NB400-114
Western Blot: Fatty Acid Synthase/FASN Antibody [NB400-114] - Expression of Fatty Acid Synthase in chicken hypothalamus. A: total RNA (1 ug) isolated from different tissues (brain, hypothalamus, liver and muscle) was subjected to RT-PCR using specific primers for chicken Fatty Acid Synthase (GenBank accession JO4485) or ribosomal 18S as a control (GenBank accession AF173612) B: tissue lysates (brain, hypothalmus, liver and muscle) were subjected to Western blot as described in MATERIALS AND METHODS. Blots were incubated with anti-Fatty Acid Synthase antibody and revealed by enhanced chemiluminescence. Picture compliments of Dridi S. et al, Am J Physiol Regul Integr Comp Physiol. 2006 Jul;291(1):R138-47. Epub 2006 Feb 2.
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody [NB400-114] - The Fas antibody was tested in MCF-7 cells at a 1:2000 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: Fatty Acid Synthase/FASN Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(23 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin: Insulin Receptor beta Antibody [NBP2-12793] - Staining shows expression of insulin receptor beta in the Cortex in mouse brain. Dilution 1:500
Immunoprecipitation: Insulin Receptor beta Antibody [NBP2-12793] - Samples: Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug), Jurkat (J; 50 ug) and mouse NIH3T3 (M; 50 ug) cells. Antibodies: Affinity purified rabbit anti-Insulin Receptor Beta antibody NBP2-12793 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 6 ug/mg lysate. Insulin Receptor Beta was also immunoprecipitated by rabbit anti-Insulin Receptor Beta antibody, which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 30 seconds (A and B).
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Glycerol Kinase
Antibody
NBP1-57033
Glycerol Kinase Antibody
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for Glycerol Kinase Antibody (NBP1-57033) (0)

There are no publications for Glycerol Kinase Antibody (NBP1-57033).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Glycerol Kinase Antibody (NBP1-57033) (1) 31

Average Rating: 3
(Based on 1 review)

Reviews using NBP1-57033:
Filter by Applications
WB
(1)
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot Glycerol Kinase NBP1-57033
Enlarge 		3
reviewed by:
Anony- mous
 WB 09/25/2014
View

Summary

ApplicationWestern Blot
Special ApplicationsImage and protocol courtesy of Brian Stogsdill, Wright University.
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycerol Kinase Antibody (NBP1-57033) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Glycerol Kinase Products

Bioinformatics Tool for Glycerol Kinase Antibody (NBP1-57033)

Discover related pathways, diseases and genes to Glycerol Kinase Antibody (NBP1-57033). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycerol Kinase Antibody (NBP1-57033)

Discover more about diseases related to Glycerol Kinase Antibody (NBP1-57033).
 

Pathways for Glycerol Kinase Antibody (NBP1-57033)

View related products by pathway.

PTMs for Glycerol Kinase Antibody (NBP1-57033)

Learn more about PTMs related to Glycerol Kinase Antibody (NBP1-57033).

Blogs on Glycerol Kinase

There are no specific blogs for Glycerol Kinase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0
Western Blot Glycerol Kinase NBP1-57033
Enlarge
 Anony- mous
09/25/2014
Application: WB
Species:
read this review

Bioinformatics

Gene Symbol GK
Uniprot