Glycerol Kinase Antibody

Images

 
Western Blot: Glycerol kinase Antibody [NBP1-57033] - U937 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glycerol Kinase Antibody Summary

Immunogen
Synthetic peptides corresponding to GK (glycerol kinase). The peptide sequence was selected from the middle region of GK. Peptide sequence MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GK and was validated on Western blot.
Control Peptide
Reviewed Applications
Read 1 Review rated 3
using
NBP1-57033 in the following application:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Glycerol Kinase Antibody

  • ATP:glycerol 3-phosphotransferase
  • EC 2.7.1.30
  • GK
  • GK1
  • GKD
  • glpK
  • Glycerokinase
  • Glycerol Kinase

Background

The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33144
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80533
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
PP-H7431-00
Species: Hu
Applications: WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75610
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
H00051776-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-69565
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-12793
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-57033
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for Glycerol Kinase Antibody (NBP1-57033) (0)

There are no publications for Glycerol Kinase Antibody (NBP1-57033).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Glycerol Kinase Antibody (NBP1-57033) (1) 31

Average Rating: 3
(Based on 1 review)

Reviews using NBP1-57033:
Filter by Applications
WB
(1)
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot Glycerol Kinase NBP1-57033
Enlarge
reviewed by:
Anony- mous
WB 09/25/2014
View

Summary

ApplicationWestern Blot
Special ApplicationsImage and protocol courtesy of Brian Stogsdill, Wright University.
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycerol Kinase Antibody (NBP1-57033) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Glycerol Kinase Products

Bioinformatics Tool for Glycerol Kinase Antibody (NBP1-57033)

Discover related pathways, diseases and genes to Glycerol Kinase Antibody (NBP1-57033). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycerol Kinase Antibody (NBP1-57033)

Discover more about diseases related to Glycerol Kinase Antibody (NBP1-57033).
 

Pathways for Glycerol Kinase Antibody (NBP1-57033)

View related products by pathway.

PTMs for Glycerol Kinase Antibody (NBP1-57033)

Learn more about PTMs related to Glycerol Kinase Antibody (NBP1-57033).

Blogs on Glycerol Kinase

There are no specific blogs for Glycerol Kinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anony- mous
09/25/2014
Application: WB
Species:

Bioinformatics

Gene Symbol GK
Uniprot