Reactivity | Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to GK (glycerol kinase). The peptide sequence was selected from the middle region of GK. Peptide sequence MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | GK |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | This is a rabbit polyclonal antibody against GK and was validated on Western blot. |
||
Control Peptide |
|
||
Reviewed Applications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anony- mous |
WB | 09/25/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for Glycerol Kinase Antibody (NBP1-57033)Discover more about diseases related to Glycerol Kinase Antibody (NBP1-57033).
| Pathways for Glycerol Kinase Antibody (NBP1-57033)View related products by pathway.
|
PTMs for Glycerol Kinase Antibody (NBP1-57033)Learn more about PTMs related to Glycerol Kinase Antibody (NBP1-57033).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.