Glycerol 3 Phosphate Dehydrogenase Antibody

Images

 
Western Blot: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-87411] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunohistochemistry-Paraffin: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-87411] - Staining of human skeletal muscle shows high expresesion.
Western Blot: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-87411] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-87411] - Staining of human prostate shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-87411] - Staining in human skeletal muscle and prostate tissues using anti-GPD1 antibody. Corresponding GPD1 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Glycerol 3 Phosphate Dehydrogenase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 24549054). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Glycerol 3 Phosphate Dehydrogenase Recombinant Protein Antigen (NBP1-87411PEP)
Publications
Read Publication using
NBP1-87411 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24549054).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glycerol 3 Phosphate Dehydrogenase Antibody

  • EC 1.1.1
  • EC 1.1.1.8
  • FLJ26652
  • glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
  • glycerol-3-phosphate dehydrogenase 1 (soluble)
  • glycerol-3-phosphate dehydrogenase, soluble
  • GPD-C
  • GPDH-C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-86121
Species: Hu
Applications: IHC, IHC-P, WB
AF6695
Species: Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-84597
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-15687
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-19860
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-26444
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-87411)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-87411) (0)

There are no reviews for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-87411). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-87411) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glycerol 3 Phosphate Dehydrogenase Products

Bioinformatics Tool for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-87411)

Discover related pathways, diseases and genes to Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-87411). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-87411)

Discover more about diseases related to Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-87411).
 

Pathways for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-87411)

View related products by pathway.

PTMs for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-87411)

Learn more about PTMs related to Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-87411).

Blogs on Glycerol 3 Phosphate Dehydrogenase

There are no specific blogs for Glycerol 3 Phosphate Dehydrogenase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glycerol 3 Phosphate Dehydrogenase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPD1