Glutathione S-Transferase pi 1/GSTP1 Antibody


Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Glutathione S-Transferase pi 1/GSTP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLS
Specificity of human Glutathione S-Transferase pi 1/GSTP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glutathione S-Transferase pi 1/GSTP1 Protein (NBP1-84747PEP)
Read Publication using NBP1-84747.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%). Reactivity reported in scientific literature (PMID: 22619634)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Glutathione S-Transferase pi 1/GSTP1 Antibody

  • deafness, X-linked 7
  • DFN7
  • EC
  • FAEES3
  • fatty acid ethyl ester synthase III
  • glutathione S-transferase P
  • Glutathione STransferase pi 1
  • Glutathione S-Transferase pi 1
  • GST class-pi
  • GST3DFN7
  • GSTP
  • GSTP1
  • GSTP1-1
  • PI


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84747)(1)

Reviews for Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84747) (0)

There are no reviews for Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84747). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84747) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Glutathione S-Transferase pi 1/GSTP1 Products

Bioinformatics Tool for Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84747)

Discover related pathways, diseases and genes to Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84747). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84747)

Discover more about diseases related to Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84747).

Pathways for Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84747)

View related products by pathway.

PTMs for Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84747)

Learn more about PTMs related to Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84747).

Research Areas for Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84747)

Find related products by research area.

Blogs on Glutathione S-Transferase pi 1/GSTP1

There are no specific blogs for Glutathione S-Transferase pi 1/GSTP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Glutathione S-Transferase pi 1/GSTP1 Antibody and receive a gift card or discount.


Gene Symbol GSTP1