Glutamine Synthetase Recombinant Protein Antigen

Images

 
There are currently no images for Glutamine Synthetase Protein (NBP1-89767PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Glutamine Synthetase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLUL.

Source: E.coli

Amino Acid Sequence: RVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GLUL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89767.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Glutamine Synthetase Recombinant Protein Antigen

  • cell proliferation-inducing protein 59
  • EC 4.1.1.15
  • EC 6.3.1.2
  • GLNSPIG59
  • Glutamate decarboxylase
  • glutamate-ammonia ligase (glutamine synthase)
  • glutamate-ammonia ligase
  • Glutamate--ammonia ligase
  • glutamine synthase
  • glutamine synthetase
  • GS
  • PIG43
  • proliferation-inducing protein 43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP1-89766
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7906
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-21598
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89767PEP
Species: Hu
Applications: AC

Publications for Glutamine Synthetase Protein (NBP1-89767PEP) (0)

There are no publications for Glutamine Synthetase Protein (NBP1-89767PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutamine Synthetase Protein (NBP1-89767PEP) (0)

There are no reviews for Glutamine Synthetase Protein (NBP1-89767PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Glutamine Synthetase Protein (NBP1-89767PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glutamine Synthetase Products

Bioinformatics Tool for Glutamine Synthetase Protein (NBP1-89767PEP)

Discover related pathways, diseases and genes to Glutamine Synthetase Protein (NBP1-89767PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutamine Synthetase Protein (NBP1-89767PEP)

Discover more about diseases related to Glutamine Synthetase Protein (NBP1-89767PEP).
 

Pathways for Glutamine Synthetase Protein (NBP1-89767PEP)

View related products by pathway.

PTMs for Glutamine Synthetase Protein (NBP1-89767PEP)

Learn more about PTMs related to Glutamine Synthetase Protein (NBP1-89767PEP).
 

Research Areas for Glutamine Synthetase Protein (NBP1-89767PEP)

Find related products by research area.

Blogs on Glutamine Synthetase

There are no specific blogs for Glutamine Synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glutamine Synthetase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GLUL