Glutamate Dehydrogenase Antibody - BSA Free

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962] - Human brain cortex.

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Human Fetal Liver Lysate, concentration 1ug/ml.

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - lanes 5: rat kidney cordex lanes 6: rat kidney proximal tubules prepped from cortex lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate lanes 8: rat brain supernatant.

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Tissue: Human Fetal Liver, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Type: 293T Antibody Dilution: 1.0 ug/ml GLUD1 is supported by BioGPS gene expression data to be expressed in HEK293T

Western Blot: Glutamate Dehydrogenase Antibody [NBP1-54962] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml

Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962] - Human pancreas tissue.

Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody [NBP1-54962] - Human kidney, renal tubular epithelium in cortex.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Glutamate Dehydrogenase Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GLUD1(glutamate dehydrogenase 1) The peptide sequence was selected from the N terminal of GLUD1 (NP_005262). Peptide sequence: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER. The peptide sequence for this immunogen was taken from within the described region.
• Marker: Mitochondria Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLUD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 56 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Glutamate Dehydrogenase Antibody - BSA Free

• EC 1.4.1
• EC 1.4.1.3
• GDH 1
• GDH
• GDH1
• GLUD
• glutamate dehydrogenase (NAD(P)+)
• Glutamate Dehydrogenase 1
• glutamate dehydrogenase 1, mitochondrial
• MGC132003

Background

L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate (Smith et al., 2001 [PubMed 11254391]). Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification (Mavrothalassitis et al., 1988 [PubMed 3368458]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 M20867.1 1-51 52-3120 BC112946.1 16-3084

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLUD1
• Entrez:
  • 2746(Human)
  • 14661(Mouse)
  • 24399(Rat)
• Uniprot:
  • P00367(Human)