Glut2 Antibody

Images

 
Western Blot: Glut2 Antibody [NBP1-69466] - This Anti-SLC2A2 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.
Western Blot: Glut2 Antibody [NBP1-69466] - Sample Tissue: Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glut2 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC2A2(solute carrier family 2 (facilitated glucose transporter), member 2) The peptide sequence was selected from the N terminal of human SLC2A2. Peptide sequence ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC2A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SLC2A2 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Glut2 Antibody

  • GLUT2 Glucose transporter type 2, liver
  • Glut2
  • GLUT-2
  • SLC2A2
  • solute carrier family 2 (facilitated glucose transporter), member 2
  • solute carrier family 2, facilitated glucose transporter member 2

Background

Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor.Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-47980
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P, IP
MAB1415
Species: Hu
Applications: Flow, CyTOF-ready, ICC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
H00144195-R01
Species: Hu
AF6014
Species: Hu, Mu, Rt
Applications: WB
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP1-57033
Species: Hu
Applications: WB
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF6347
Species: Hu
Applications: WB

Publications for Glut2 Antibody (NBP1-69466) (0)

There are no publications for Glut2 Antibody (NBP1-69466).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glut2 Antibody (NBP1-69466) (0)

There are no reviews for Glut2 Antibody (NBP1-69466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glut2 Antibody (NBP1-69466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glut2 Products

Bioinformatics Tool for Glut2 Antibody (NBP1-69466)

Discover related pathways, diseases and genes to Glut2 Antibody (NBP1-69466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glut2 Antibody (NBP1-69466)

Discover more about diseases related to Glut2 Antibody (NBP1-69466).
 

Pathways for Glut2 Antibody (NBP1-69466)

View related products by pathway.

PTMs for Glut2 Antibody (NBP1-69466)

Learn more about PTMs related to Glut2 Antibody (NBP1-69466).

Blogs on Glut2

There are no specific blogs for Glut2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glut2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC2A2
Entrez
Uniprot