Glut2 Antibody


Western Blot: Glut2 Antibody [NBP1-69466] - This Anti-SLC2A2 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.
Western Blot: Glut2 Antibody [NBP1-69466] - Sample Tissue: Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate more

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Glut2 Antibody Summary

Synthetic peptides corresponding to SLC2A2(solute carrier family 2 (facilitated glucose transporter), member 2) The peptide sequence was selected from the N terminal of human SLC2A2. Peptide sequence ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNY
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SLC2A2 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Glut2 Antibody

  • GLUT2 Glucose transporter type 2, liver
  • Glut2
  • GLUT-2
  • SLC2A2
  • solute carrier family 2 (facilitated glucose transporter), member 2
  • solute carrier family 2, facilitated glucose transporter member 2


Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor.Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P, IP
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu
Applications: WB

Publications for Glut2 Antibody (NBP1-69466) (0)

There are no publications for Glut2 Antibody (NBP1-69466).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glut2 Antibody (NBP1-69466) (0)

There are no reviews for Glut2 Antibody (NBP1-69466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glut2 Antibody (NBP1-69466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Glut2 Products

Bioinformatics Tool for Glut2 Antibody (NBP1-69466)

Discover related pathways, diseases and genes to Glut2 Antibody (NBP1-69466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glut2 Antibody (NBP1-69466)

Discover more about diseases related to Glut2 Antibody (NBP1-69466).

Pathways for Glut2 Antibody (NBP1-69466)

View related products by pathway.

PTMs for Glut2 Antibody (NBP1-69466)

Learn more about PTMs related to Glut2 Antibody (NBP1-69466).

Blogs on Glut2

There are no specific blogs for Glut2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Glut2 Antibody and receive a gift card or discount.


Gene Symbol SLC2A2