GLUT10 Antibody - BSA Free

Immunohistochemistry-Paraffin: GLUT10 Antibody [NBP2-13326] - Staining of human appendix shows strong cytoplasmic and membranous positivity in glandular cells.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GLUT10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GLUT10 Antibody - BSA Free (NBP2-13326) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMRG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC2A10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GLUT10 Protein (NBP2-13326PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GLUT10 Antibody - BSA Free

• ATS
• Glucose transporter type 10
• GLUT-10
• GLUT10MGC126706
• solute carrier family 2 (facilitated glucose transporter), member 10
• solute carrier family 2, facilitated glucose transporter member 10

Background

Non-insulin-dependent diabetes mellitus (NIDDM) is a multifactoral disease with both environmental and genetics causes. Genome-wide screening procedures have identified several susceptibility loci for NIDDM within the human genome. A putative sugar transporter that has been localized to human chromosome 20q12-q13.1, one of the genomic loci associated with NIDDM. Because of the strong resemblance of this novel protein to members of the mammalian facilitative glucose transporter family (GLUT), the protein is known as GLUT10 (HGMW-approved gene symbol SLC2A10). Data suggests that GLUT10 an excellent candidate for a susceptibility gene involved in NIDDM.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC2A10